close all open/close all

CDS information : Dauno_00110


close this sectionLocation

Organism
StrainC5
Entry nameDaunorubicin
Contig
Start / Stop / Direction20,206 / 21,102 / + [in whole cluster]
2,936 / 3,832 / + [in contig]
Location20206..21102 [in whole cluster]
2936..3832 [in contig]
TypeCDS
Length897 bp (298 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.4 other modification
Productrhodomycin D esterase
Product (GenBank)esterase
Gene
Gene (GenBank)dauP
EC number
Keyword
Note
Note (GenBank)
  • putative
Reference
ACC
PmId
[7836284] Analysis of clustered genes encoding both early and late steps in daunomycin biosynthesis by Streptomyces sp. strain C5. (J Bacteriol. , 1995)
[9098063] In vivo and in vitro bioconversion of epsilon-rhodomycinone glycoside to doxorubicin: functions of DauP, DauK, and DoxA. (J Bacteriol. , 1997)

close this sectionSequence

selected fasta
>rhodomycin D esterase [esterase]
MPTRMITKDEVTLWSEGIGDPADAPLLLIAGGNLSARSWPDEFVERLAAAGHFVIRYDHR
DTGRSSRYDFALHPYGFDELATDALAVLDAWQVRAAHVVGMSLGNTIGQLLALDAPERLL
TLTVMLGGALDVDFDADLEAALKGEPSVSGLPVPSRRFLDMMMLLQQPAGTDEELLERRV
EKWRLLNGEGVPFDSDEFRRRELLAAGHAGTFDEPIVHHMIPQPPVSRGAELARITTPVL
AIQAMCDPAAPPPHARHLADRIPGARVVEIENMGHALPLAVHEPLAAAICAHTRAATV
selected fasta
>rhodomycin D esterase [esterase]
ATGCCGACACGCATGATCACCAAGGACGAGGTGACCTTGTGGAGCGAAGGAATCGGCGAT
CCGGCCGACGCTCCGTTGCTCCTGATCGCCGGCGGCAACCTTTCGGCCAGGTCATGGCCG
GACGAGTTCGTTGAACGCCTCGCCGCGGCCGGGCACTTCGTGATCCGCTACGACCACCGG
GACACAGGGCGCTCCTCCCGGTACGACTTCGCGCTCCACCCCTACGGCTTCGACGAGCTG
GCCACCGACGCGCTGGCCGTCCTGGACGCCTGGCAGGTCCGCGCCGCCCATGTGGTGGGC
ATGTCGCTGGGCAACACCATCGGCCAGTTGCTCGCCCTGGACGCTCCGGAGCGTCTCCTG
ACACTCACCGTCATGCTGGGGGGTGCGCTCGATGTCGACTTCGACGCCGACCTGGAGGCG
GCGCTCAAAGGTGAGCCTTCCGTCAGCGGACTGCCGGTGCCCAGCCGACGGTTCCTCGAC
ATGATGATGCTTCTTCAGCAGCCGGCCGGGACGGACGAGGAACTACTGGAGCGCCGGGTG
GAGAAGTGGCGCCTGCTCAACGGGGAGGGAGTGCCTTTCGACTCCGACGAGTTCCGGCGC
CGTGAACTCCTGGCCGCCGGTCACGCGGGAACGTTCGACGAGCCGATCGTGCACCACATG
ATCCCGCAGCCGCCGGTGTCGCGGGGGGCGGAGTTGGCCCGCATCACGACACCGGTACTG
GCGATCCAGGCGATGTGCGACCCCGCGGCCCCGCCGCCGCACGCCCGGCACCTGGCCGAC
CGAATTCCCGGCGCCCGGGTCGTGGAGATCGAGAACATGGGGCACGCGCTGCCCCTCGCG
GTCCACGAACCGCTGGCCGCCGCCATCTGCGCCCATACCCGGGCCGCGACCGTGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
No significant hit
SignalP No significant hit
TMHMM No significant hit