close all open/close all
Dauno_00110 Dauno_00110   last last

CDS information : Dauno_00120


close this sectionLocation

Organism
StrainC5
Entry nameDaunorubicin
Contig
Start / Stop / Direction21,108 / 21,404 / + [in whole cluster]
3,838 / 4,134 / + [in contig]
Location21108..21404 [in whole cluster]
3838..4134 [in contig]
TypeCDS
Length297 bp (98 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.3 modification addition of sugar moiety
Productputative glycosyltransferase helper protein(fragment)
Product (GenBank)
Gene
Gene (GenBank)dauQ
EC number
Keyword
  • daunosamine
Note
Note (GenBank)
  • putative
Reference
ACC
PmId
[7836284] Analysis of clustered genes encoding both early and late steps in daunomycin biosynthesis by Streptomyces sp. strain C5. (J Bacteriol. , 1995)
Related Reference
ACC
Q54823
NITE
Adria_00350
PmId
[7592454] Cloning and characterization of the Streptomyces peucetius dnrQS genes encoding a daunosamine biosynthesis enzyme and a glycosyl transferase involved in daunorubicin biosynthesis. (J Bacteriol. , 1995)
[17049185] Functional analysis of desVIII homologues involved in glycosylation of macrolide antibiotics by interspecies complementation. (Gene. , 2007)
ACC
Q9L4U5
NITE
Acla_00220
PmId
[15911373] AknT is an activating protein for the glycosyltransferase AknS in L-aminodeoxysugar transfer to the aglycone of aclacinomycin A. (Chem Biol. , 2005)
[17685523] Characterization of rhodosaminyl transfer by the AknS/AknT glycosylation complex and its use in reconstituting the biosynthetic pathway of aclacinomycin A. (J Am Chem Soc. , 2007)
ACC
Q9ZGH8
NITE
Pikro_00080
PmId
[20695498] Characterization of glycosyltransferase DesVII and its auxiliary partner protein DesVIII in the methymycin/picromycin biosynthetic pathway. (Biochemistry. , 2010)
[26552796] In vivo investigation to the macrolide-glycosylating enzyme pair DesVII/DesVIII in Saccharopolyspora erythraea. (Appl Microbiol Biotechnol. , 2016)

close this sectionSequence

selected fasta
>putative glycosyltransferase helper protein(fragment)
MTMPTPTSAPPAAPTNSELGRHLLTVRGFHFVFGALGDPYARRLRGEADHLSLGELVRDR
GPLHRSALGTWVTADGETSAGLLDDPLLGPRHPASEGLQ
selected fasta
>putative glycosyltransferase helper protein(fragment)
ATGACGATGCCCACACCCACGTCCGCGCCGCCGGCCGCCCCGACCAACAGCGAGCTGGGG
CGCCATCTGCTGACCGTGCGCGGCTTCCACTTCGTCTTCGGCGCGCTGGGCGACCCCTAT
GCCCGGCGACTGCGCGGCGAAGCCGATCATCTGTCTCTCGGTGAACTGGTCCGCGACCGA
GGTCCGCTCCACCGCAGTGCGCTGGGCACCTGGGTGACGGCGGACGGAGAAACATCGGCC
GGCCTGCTGGACGATCCGCTGCTGGGCCCTCGGCACCCCGCCTCGGAAGGGCTGCAG

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro No significant hit
SignalP
 [1-37]  0.229 Signal
Eukaryota   
TMHMM No significant hit
Dauno_00110 Dauno_00110   last last