close all open/close all

CDS information : Dauno_00130


close this sectionLocation

Organism
StrainC5
Entry nameDaunorubicin
Contig
Start / Stop / Direction10,501 / 9,554 / - [in whole cluster]
1,320 / 373 / - [in contig]
Locationcomplement(9554..10501) [in whole cluster]
complement(373..1320) [in contig]
TypeCDS
Length948 bp (315 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.4 other modification
Productputative cyclase/dehydratase
Product (GenBank)cyclase/dehydrase
GenedpsF
Gene (GenBank)dauA
EC number
Keyword
  • 1st ring
Note
Note (GenBank)
  • ORFF; putative
Reference
ACC
PmId
[7928998] Isolation and sequence analysis of polyketide synthase genes from the daunomycin-producing Streptomyces sp. strain C5. (J Bacteriol. , 1994)
[9098068] Minimal Streptomyces sp. strain C5 daunorubicin polyketide biosynthesis genes required for aklanonic acid biosynthesis. (J Bacteriol. , 1997)
Related Reference
ACC
Q54811
NITE
Adria_00240
PmId
[9224566] Iterative type II polyketide synthases, cyclases and ketoreductases exhibit context-dependent behavior in the biosynthesis of linear and angular decapolyketides. (Chem Biol. , 1997)

close this sectionSequence

selected fasta
>putative cyclase/dehydratase [cyclase/dehydrase]
MSESPLQQTEHEIHTSAAPDAVFAVLADVRSWPAVFPPSVHVEQLECADSSERIRIWATA
NGSLRTWTSRRELDERVRRIRFRQETSAHPVAAMGGEWIVEEAGDGGTRVRLTHDFRAVD
DDPETIGWIHRAVDRNSEAELASLRTALEGPDGTAPTTFEDTVVVRGSAEDIYRFLHRSD
LWEKRLSHVARIAVKEEEPGLQHMEMDTLTADGSVHTTASVRVCFPERRLIVYKQLRTPP
LLALHLGRWSVRPAGDGDGIAVTSAHTVSVARSAIPGILGAGANETDAVDFVRRALGRNS
LLTLEAARRYAESSA
selected fasta
>putative cyclase/dehydratase [cyclase/dehydrase]
ATGTCCGAGTCGCCGCTTCAGCAGACCGAGCACGAGATCCATACCTCGGCCGCGCCGGAC
GCCGTGTTCGCCGTGCTGGCCGACGTGCGGTCCTGGCCCGCCGTGTTCCCGCCCAGTGTC
CACGTCGAACAGTTGGAGTGCGCGGACTCCAGCGAACGCATCCGCATCTGGGCCACTGCC
AACGGCTCGCTTCGTACCTGGACGTCGCGGCGCGAGCTCGACGAGCGGGTCCGGCGCATC
CGTTTCCGGCAGGAGACGTCCGCCCACCCCGTCGCAGCCATGGGCGGCGAATGGATCGTC
GAGGAAGCCGGTGACGGCGGCACCCGCGTGCGGCTGACGCACGACTTCCGGGCCGTGGAC
GACGACCCGGAGACGATCGGCTGGATCCATCGGGCCGTGGACCGCAACAGCGAAGCCGAA
CTGGCGTCGCTGCGCACCGCGCTGGAAGGACCCGACGGCACCGCTCCGACGACCTTCGAG
GACACCGTCGTCGTCCGTGGCAGTGCCGAGGACATCTACCGCTTCCTCCATCGCAGCGAC
CTCTGGGAGAAGCGGCTCTCCCACGTCGCGCGGATCGCGGTCAAGGAGGAGGAACCGGGT
CTGCAGCACATGGAGATGGACACCCTCACCGCGGACGGCTCGGTACACACCACCGCGTCG
GTGCGCGTGTGCTTCCCCGAACGCCGCCTCATCGTCTACAAGCAACTGCGCACGCCGCCG
CTGCTGGCGCTCCATCTCGGCCGCTGGTCGGTCCGTCCCGCCGGCGACGGGGACGGGATC
GCCGTCACGTCGGCCCACACCGTGTCCGTGGCCCGCTCGGCGATCCCCGGCATCCTAGGT
GCGGGGGCGAATGAGACGGACGCCGTGGACTTCGTCCGCCGGGCCCTGGGCCGCAACAGT
CTGCTGACCCTGGAAGCGGCCAGACGGTACGCCGAGTCCAGCGCCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR019587 Polyketide cyclase/dehydrase (Family)
 [8-149]  2.3e-15 PF10604 [158-312]  2.5e-06 PF10604
PF10604   Polyketide_cyc2
IPR023393 START-like domain (Domain)
 [7-148]  2.3e-13 G3DSA:3.30.530.20
G3DSA:3.30.530.20   G3DSA:3.30.530.20
SignalP No significant hit
TMHMM No significant hit