close all open/close all

CDS information : Dauno_00140


close this sectionLocation

Organism
StrainC5
Entry nameDaunorubicin
Contig
Start / Stop / Direction11,319 / 10,531 / - [in whole cluster]
2,138 / 1,350 / - [in contig]
Locationcomplement(10531..11319) [in whole cluster]
complement(1350..2138) [in contig]
TypeCDS
Length789 bp (262 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.3 modification reduction
Productputative polyketide C-9 ketoreductase
Product (GenBank)polyketide reductase
GenedpsE
Gene (GenBank)dauB
EC number
Keyword
Note
Note (GenBank)
  • putative
Reference
ACC
PmId
[7928998] Isolation and sequence analysis of polyketide synthase genes from the daunomycin-producing Streptomyces sp. strain C5. (J Bacteriol. , 1994)
[9098068] Minimal Streptomyces sp. strain C5 daunorubicin polyketide biosynthesis genes required for aklanonic acid biosynthesis. (J Bacteriol. , 1997)
Related Reference
ACC
Q54812
NITE
Adria_00250
PmId
[9224566] Iterative type II polyketide synthases, cyclases and ketoreductases exhibit context-dependent behavior in the biosynthesis of linear and angular decapolyketides. (Chem Biol. , 1997)

close this sectionSequence

selected fasta
>putative polyketide C-9 ketoreductase [polyketide reductase]
MSDAADRVALVTGGTSGIGLAVGRRKLALDGTRVFLCARDESAVTGTVKELQASGLEVEG
TSCDVRSTDAVDRLVRTARNPLRAIDIVVNNAGRGGGGVTAQITDDLWSDVVDTNLGGAF
RVTRAVLTGGGMQEHGWGRIINIASTGGKQGVALGAPYSASKSGLIGFTKAVALELARTG
ITVNAVCPGYVETPMAQGVRQRYAAFWGITEDDVLEKFRAKIPLGRYSTSDEVAGMVHYL
VSDSADSITAQAINVCGGLGSY
selected fasta
>putative polyketide C-9 ketoreductase [polyketide reductase]
ATGTCCGACGCAGCCGACCGGGTCGCACTTGTCACCGGGGGAACCAGCGGCATCGGTCTC
GCGGTAGGACGACGCAAGCTCGCCCTGGACGGGACCCGGGTGTTCCTGTGCGCTCGTGAC
GAGAGCGCCGTCACCGGCACCGTGAAGGAACTTCAGGCATCGGGACTGGAGGTGGAGGGC
ACGTCCTGCGACGTGCGGAGCACCGACGCTGTCGACCGGCTGGTCCGAACGGCCCGGAAC
CCGCTTCGGGCGATCGACATCGTCGTCAACAACGCCGGCCGCGGTGGTGGAGGAGTGACC
GCCCAGATCACGGACGACCTGTGGTCCGATGTCGTCGACACCAACCTCGGCGGGGCCTTC
CGGGTCACCCGCGCCGTCCTCACCGGCGGCGGCATGCAGGAGCACGGCTGGGGCCGGATC
ATCAACATCGCCTCTACCGGCGGCAAGCAGGGAGTGGCCCTCGGCGCTCCCTACTCCGCC
TCCAAGAGCGGCCTGATCGGCTTCACGAAGGCTGTCGCACTGGAGCTGGCCAGGACGGGC
ATCACGGTCAACGCCGTCTGCCCGGGGTACGTCGAGACGCCCATGGCCCAAGGCGTGCGG
CAGCGATACGCCGCCTTCTGGGGGATCACCGAGGACGACGTCCTGGAGAAGTTCCGGGCG
AAGATCCCGCTCGGACGCTACTCGACGTCCGACGAGGTGGCCGGAATGGTGCACTACCTG
GTCTCCGACAGCGCCGACTCGATCACGGCCCAGGCCATCAATGTCTGTGGTGGCCTCGGC
AGTTACTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR002198 Short-chain dehydrogenase/reductase SDR (Family)
 [83-94]  1.20000117458134e-13 PR00080 [138-146]  1.20000117458134e-13 PR00080 [158-177]  1.20000117458134e-13 PR00080
PR00080   SDRFAMILY
 [8-176]  7.10000000000008e-35 PF00106
PF00106   adh_short
IPR002347 Glucose/ribitol dehydrogenase (Family)
 [8-25]  8.39998014024981e-45 PR00081 [83-94]  8.39998014024981e-45 PR00081 [132-148]  8.39998014024981e-45 PR00081 [158-177]  8.39998014024981e-45 PR00081 [179-196]  8.39998014024981e-45 PR00081 [223-243]  8.39998014024981e-45 PR00081
PR00081   GDHRDH
IPR016040 NAD(P)-binding domain (Domain)
 [3-259]  2.20000000000002e-75 G3DSA:3.40.50.720
G3DSA:3.40.50.720   NAD(P)-bd
IPR020904 Short-chain dehydrogenase/reductase, conserved site (Conserved_site)
 [145-173]  PS00061
PS00061   ADH_SHORT
SignalP No significant hit
TMHMM No significant hit