close all open/close all

CDS information : Dauno_00150


close this sectionLocation

Organism
StrainC5
Entry nameDaunorubicin
Contig
Start / Stop / Direction11,498 / 11,893 / + [in whole cluster]
2,317 / 2,712 / + [in contig]
Location11498..11893 [in whole cluster]
2317..2712 [in contig]
TypeCDS
Length396 bp (131 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.3 modification reduction
Productputative C-12 oxygenase
Product (GenBank)oxygenase
GenedauG
Gene (GenBank)
EC number
Keyword
  • anthraquinone
Note
Note (GenBank)
  • ORFE; putative
Reference
ACC
PmId
[7928998] Isolation and sequence analysis of polyketide synthase genes from the daunomycin-producing Streptomyces sp. strain C5. (J Bacteriol. , 1994)
[9098068] Minimal Streptomyces sp. strain C5 daunorubicin polyketide biosynthesis genes required for aklanonic acid biosynthesis. (J Bacteriol. , 1997)
Related Reference
ACC
Q8VWB4
PmId
[12399480] Expression, purification, and characterization of AknX anthrone oxygenase, which is involved in aklavinone biosynthesis in Streptomyces galilaeus. (J Bacteriol. , 2002)
ACC
O54259
NITE
Nogl_00350
PmId
[19255477] Expression, purification and crystallization of the cofactor-independent monooxygenase SnoaB from the nogalamycin biosynthetic pathway. (Acta Crystallogr Sect F Struct Biol Cryst Commun. , 2009)
[20052967] Crystal structure of the cofactor-independent monooxygenase SnoaB from Streptomyces nogalater: implications for the reaction mechanism. (Biochemistry. , 2010)

close this sectionSequence

selected fasta
>putative C-12 oxygenase [oxygenase]
MEQRCLWPEPNDAGSGSVTFVNRFTLSGSAEDFEAAFAETAEFLCRRPGFRWHVLLAPTG
SGSADVRPQYVNIAVWDDEASFRAAVAHPQFPAHAAVLRALSTSEPTLYRSRQIRVAPGA
PAMSRPEGRTT
selected fasta
>putative C-12 oxygenase [oxygenase]
GTGGAGCAGCGATGCCTCTGGCCAGAACCGAACGACGCCGGCTCCGGGTCGGTGACCTTC
GTCAACCGATTCACCCTGAGCGGATCAGCCGAGGACTTCGAGGCGGCGTTCGCCGAAACG
GCCGAGTTCCTGTGTCGCCGACCCGGCTTCCGCTGGCACGTCCTGCTGGCGCCGACCGGC
TCCGGCTCGGCCGACGTCCGCCCGCAGTACGTGAACATCGCGGTCTGGGACGACGAGGCC
TCCTTCCGTGCCGCTGTGGCGCACCCGCAGTTCCCGGCCCACGCGGCCGTCCTGCGGGCG
CTGAGCACCAGCGAACCGACCCTGTACCGGTCCCGTCAGATCCGTGTCGCGCCGGGCGCC
CCGGCCATGAGCAGGCCCGAAGGGCGGACGACGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR007138 Antibiotic biosynthesis monooxygenase (Domain)
 [18-96]  1.99999999999999e-19 PF03992
PF03992   ABM
IPR011008 Dimeric alpha-beta barrel (Domain)
 [8-123]  1.20000117458134e-16 SSF54909
SSF54909   Dimer_A_B_barrel
SignalP
 [1-35]  0.284 Signal
Bacteria, Gram-positive   
TMHMM No significant hit