close all open/close all

CDS information : Dauno_00160


close this sectionLocation

Organism
StrainC5
Entry nameDaunorubicin
Contig
Start / Stop / Direction11,890 / 13,146 / + [in whole cluster]
2,709 / 3,965 / + [in contig]
Location11890..13146 [in whole cluster]
2709..3965 [in contig]
TypeCDS
Length1,257 bp (418 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category1.1 PKS
Productpolyketide synthase beta-ketoacyl synthase subunit
Product (GenBank)polyketide synthase
GenedpsA
Gene (GenBank)
EC number
Keyword
  • type II PKS
Note
Note (GenBank)
  • ORFA; putative
Reference
ACC
PmId
[7928998] Isolation and sequence analysis of polyketide synthase genes from the daunomycin-producing Streptomyces sp. strain C5. (J Bacteriol. , 1994)
[9098068] Minimal Streptomyces sp. strain C5 daunorubicin polyketide biosynthesis genes required for aklanonic acid biosynthesis. (J Bacteriol. , 1997)

close this sectionPKS/NRPS Module

KS3..374

close this sectionSequence

selected fasta
>polyketide synthase beta-ketoacyl synthase subunit [polyketide synthase]
MNRRVVITGMGVVAPGAIGIKSFWELLLSGTTATRAITTFDATPFRSRIAAECDFDPVAA
GLSAEQARRLDRAGQFALVAGQEALTDSGLRIGEDSAHRVGVCVGTAVGCTQKLESEYVA
LSAGGANWVVDPHRGAPELYDYFVPSSLAAEVAWLAGAEGPVNIVSAGCTSGIDSIGYAC
ELIREGTVDVMLAGGVDAPIAPITVACFDAIRVTSDHNDTPETLAPFSRSRNGFVLGEGG
AIVVLEEAEAAVRRGARIYAEIGGYASRGNAYHMTGLRADGAEMAAAITAALDEARRDPS
DVDYVNAHGTATRQNDRHETSAFKRSLGDHAYRVPISSVKSMIGHSLGAAGSLEVAATAL
AVEYGAIPPTANLHDPDPELDLDYVPLTAREKRVRHALTVGSGFGGFQSAMLLSRPER
selected fasta
>polyketide synthase beta-ketoacyl synthase subunit [polyketide synthase]
GTGAACCGACGGGTCGTCATCACCGGGATGGGTGTGGTGGCCCCGGGAGCCATCGGCATC
AAGTCGTTCTGGGAGCTGCTGCTGTCCGGGACCACCGCCACCCGGGCCATCACCACGTTC
GACGCCACGCCCTTCCGTTCCCGGATCGCCGCCGAGTGCGACTTCGATCCGGTCGCGGCA
GGGCTGTCCGCGGAGCAGGCCCGGCGCCTCGACCGGGCCGGGCAGTTCGCGCTGGTCGCC
GGTCAGGAGGCGCTCACTGACAGCGGGCTGCGCATCGGGGAGGACTCCGCCCACCGGGTC
GGGGTGTGCGTGGGTACCGCTGTCGGCTGCACGCAGAAACTGGAGTCCGAGTACGTGGCT
CTCAGCGCGGGCGGTGCGAACTGGGTCGTGGACCCCCACCGGGGGGCGCCCGAGCTGTAC
GACTACTTCGTGCCGAGTTCCCTCGCCGCCGAAGTGGCTTGGCTCGCCGGGGCGGAAGGG
CCCGTGAACATCGTCTCGGCCGGGTGCACCTCGGGGATCGACTCCATCGGGTACGCCTGC
GAACTCATCCGCGAGGGGACGGTGGACGTCATGCTCGCGGGAGGCGTGGACGCCCCCATC
GCACCGATCACTGTGGCCTGCTTCGACGCCATCAGGGTGACCTCCGACCACAACGACACA
CCCGAGACGCTCGCGCCCTTCAGCCGCAGCCGCAACGGCTTCGTGCTGGGCGAGGGTGGT
GCGATCGTGGTTCTGGAAGAGGCAGAGGCGGCCGTGCGCAGGGGCGCACGAATCTACGCC
GAGATCGGCGGGTACGCCTCACGCGGCAACGCATACCACATGACGGGGCTGCGCGCAGAC
GGCGCCGAGATGGCTGCGGCGATTACCGCGGCCCTCGACGAAGCCCGCCGCGACCCCTCG
GACGTGGACTATGTCAACGCCCACGGAACAGCGACGCGACAGAACGACCGGCACGAAACC
TCCGCGTTCAAGCGCTCGCTGGGGGATCACGCGTACCGGGTTCCCATCAGCTCCGTGAAG
TCGATGATCGGTCACTCCCTGGGGGCCGCCGGCTCGCTCGAAGTGGCGGCGACCGCACTG
GCGGTGGAGTACGGGGCGATCCCGCCGACCGCGAATCTGCACGACCCGGATCCCGAACTC
GACCTGGACTACGTGCCGTTGACGGCGCGAGAAAAGCGGGTGCGGCATGCGCTGACGGTG
GGCAGCGGCTTCGGCGGCTTCCAGAGCGCCATGCTGTTGAGCCGTCCCGAGAGGTGA
KS3..374
KS7..1122

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR014030 Beta-ketoacyl synthase, N-terminal (Domain)
 [3-250]  3.60000000000002e-58 PF00109
PF00109   ketoacyl-synt
IPR014031 Beta-ketoacyl synthase, C-terminal (Domain)
 [259-374]  1.80000000000002e-38 PF02801
PF02801   Ketoacyl-synt_C
IPR016038 Thiolase-like, subgroup (Domain)
 [2-262]  4.6e-62 G3DSA:3.40.47.10 [269-416]  1.99999999999999e-52 G3DSA:3.40.47.10
G3DSA:3.40.47.10   Thiolase-like_subgr
IPR016039 Thiolase-like (Domain)
 [2-418]  6.59996953923913e-66 SSF53901
SSF53901   Thiolase-like
IPR018201 Beta-ketoacyl synthase, active site (Active_site)
 [160-176]  PS00606
PS00606   B_KETOACYL_SYNTHASE
SignalP
 [1-19]  0.583 Signal
Eukaryota   
TMHMM No significant hit