close all open/close all

CDS information : Dauno_00170


close this sectionLocation

Organism
StrainC5
Entry nameDaunorubicin
Contig
Start / Stop / Direction13,233 / 14,429 / + [in whole cluster]
4,052 / 5,248 / + [in contig]
Location13233..14429 [in whole cluster]
4052..5248 [in contig]
TypeCDS
Length1,197 bp (398 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category1.1 PKS
Productpolyketide synthase chain length factor subunit
Product (GenBank)polyketide synthase
GenedpsB
Gene (GenBank)
EC number
Keyword
  • type II PKS
Note
Note (GenBank)
  • ORFB; putative
Reference
ACC
PmId
[7928998] Isolation and sequence analysis of polyketide synthase genes from the daunomycin-producing Streptomyces sp. strain C5. (J Bacteriol. , 1994)
[9098068] Minimal Streptomyces sp. strain C5 daunorubicin polyketide biosynthesis genes required for aklanonic acid biosynthesis. (J Bacteriol. , 1997)
Related Reference
ACC
Q54815
NITE
Adria_00280
PmId
[7828855] Characterization of the Streptomyces peucetius ATCC 29050 genes encoding doxorubicin polyketide synthase. (Gene. , 1994)

close this sectionPKS/NRPS Module

CLF2..354

close this sectionSequence

selected fasta
>polyketide synthase chain length factor subunit [polyketide synthase]
MVTGLGIVAPNGLGVGAIWDAVLNGRNGIGPLRRFADDGRLGRLAGEVSDFVPEDHLPKR
LLVQTDPMTQMTALAAAEWALREAGCAPSSPLEAGVITASASGGFASGQRELQNLWSKGP
AHVSAYMSFAWFYAVNTGQIAIRHDLRGPVGVVVAEQAGGLDALAHARRKVRGGAELIVS
GAMDSSLCPYGMAAQVRSGRLSGSDDPTAGYLPFDRRAAGHVPGEGGAILAVEDAERVAE
RGGKVYGSIAGTASFDPPPGSGRPSALARAVETALADAGLDRSDIAVVFADGAAVGELDV
AEAEALASVFGPHRVPVTVPKTLTGRLYSGAGPLDVATGLLALRDEVVPATGHVHPDPDL
PLDVVTGRPRAMADARAALVVARGHGGFNSALVVRGAA
selected fasta
>polyketide synthase chain length factor subunit [polyketide synthase]
GTGGTGACGGGTCTCGGGATCGTCGCCCCCAACGGGCTCGGTGTGGGCGCGATCTGGGAC
GCCGTCCTGAACGGCCGCAACGGCATCGGACCGCTGAGGCGGTTCGCCGACGACGGTCGC
CTGGGGCGGCTGGCCGGTGAGGTGAGCGACTTCGTCCCCGAGGACCATCTGCCGAAGCGG
CTGCTGGTGCAGACAGATCCGATGACCCAGATGACGGCGCTGGCCGCCGCCGAGTGGGCC
CTGCGGGAGGCCGGCTGCGCGCCGTCGTCGCCGCTGGAGGCGGGGGTGATCACGGCCAGC
GCTTCCGGCGGCTTCGCGTCCGGCCAGCGGGAATTGCAGAACCTGTGGAGCAAGGGGCCG
GCCCACGTCAGCGCCTACATGTCGTTCGCCTGGTTCTACGCCGTCAACACCGGGCAGATC
GCCATCCGCCACGACCTGCGTGGTCCGGTCGGAGTGGTGGTGGCCGAGCAGGCGGGCGGC
CTTGACGCCCTCGCCCACGCCCGCCGCAAGGTCCGGGGCGGAGCCGAGCTGATCGTCTCG
GGCGCCATGGACTCGTCATTGTGCCCGTACGGTATGGCGGCCCAGGTGAGGTCCGGTCGG
CTGAGCGGCTCGGACGACCCGACGGCCGGGTATCTGCCGTTCGACCGGCGAGCGGCCGGA
CACGTGCCCGGTGAGGGGGGCGCGATCCTCGCCGTCGAGGACGCGGAGCGCGTCGCCGAA
CGGGGCGGGAAGGTGTACGGGTCGATCGCCGGTACGGCGAGCTTCGACCCGCCCCCCGGC
TCCGGCCGCCCCTCCGCCCTCGCCCGTGCCGTCGAGACGGCGCTGGCCGACGCGGGGCTG
GACCGATCCGACATAGCCGTGGTGTTCGCCGACGGCGCGGCCGTCGGCGAACTGGACGTG
GCCGAGGCGGAGGCCCTGGCGTCGGTCTTCGGACCGCACCGGGTCCCGGTGACCGTCCCC
AAGACGCTCACCGGCCGACTGTACTCGGGAGCCGGGCCGCTGGACGTGGCCACCGGACTG
CTGGCGCTGCGGGACGAGGTGGTCCCGGCGACCGGGCACGTCCACCCGGACCCCGATCTG
CCGCTGGACGTGGTGACCGGGCGGCCCCGGGCGATGGCCGACGCCAGGGCGGCTCTCGTC
GTCGCCCGGGGCCACGGGGGTTTCAACAGCGCTCTGGTCGTCCGGGGGGCGGCGTGA
CLF2..354
CLF4..1062

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR014030 Beta-ketoacyl synthase, N-terminal (Domain)
 [2-234]  1.40000000000001e-42 PF00109
PF00109   ketoacyl-synt
IPR014031 Beta-ketoacyl synthase, C-terminal (Domain)
 [247-354]  8.70000000000003e-23 PF02801
PF02801   Ketoacyl-synt_C
IPR016038 Thiolase-like, subgroup (Domain)
 [2-251]  5.79999999999997e-44 G3DSA:3.40.47.10 [263-396]  1.6e-33 G3DSA:3.40.47.10
G3DSA:3.40.47.10   Thiolase-like_subgr
IPR016039 Thiolase-like (Domain)
 [1-243]  1.70000295590053e-45 SSF53901 [206-397]  7.2000271977897e-37 SSF53901
SSF53901   Thiolase-like
SignalP No significant hit
TMHMM No significant hit