close all open/close all

CDS information : Dauno_00180


close this sectionLocation

Organism
StrainC5
Entry nameDaunorubicin
Contig
Start / Stop / Direction14,426 / 15,484 / + [in whole cluster]
5,245 / 6,303 / + [in contig]
Location14426..15484 [in whole cluster]
5245..6303 [in contig]
TypeCDS
Length1,059 bp (352 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category1.1 PKS
Productpolyketide synthase beta-ketoacyl synthase subunit
Product (GenBank)
GenedpsC
Gene (GenBank)
EC number
Keyword
  • propionyl-CoA dependent
  • type II PKS
Note
Note (GenBank)
  • ORFC; beta-keto acyl synthase III homologue; putative
Reference
ACC
PmId
[7928998] Isolation and sequence analysis of polyketide synthase genes from the daunomycin-producing Streptomyces sp. strain C5. (J Bacteriol. , 1994)
[11162232] The product of dpsC confers starter unit fidelity upon the daunorubicin polyketide synthase of Streptomyces sp. strain C5. (Metab Eng. , 2001)
Related Reference
ACC
Q54816
NITE
Adria_00290
PmId
[10419974] The Streptomyces peucetius dpsC gene determines the choice of starter unit in biosynthesis of the daunorubicin polyketide. (J Bacteriol. , 1999)
[10423255] Purification and properties of the Streptomyces peucetius DpsC beta-ketoacyl:acyl carrier protein synthase III that specifies the propionate-starter unit for type II polyketide biosynthesis. (Biochemistry. , 1999)

close this sectionPKS/NRPS Module

KS113..338

close this sectionSequence

selected fasta
>polyketide synthase beta-ketoacyl synthase subunit
MSTLPGAPGDLYVAGCGVWLPPPVTTDQALAAGHCDRRLASSTRMLSVAVADKETPAEMA
ASAARTAVDRSGVPPARIVLVLHASLYFQGHHLWAPASYVQRVALGNRCPAMEVRQVSNG
GMAALELARAYLLAAPDRTAALVTTGDRMSPPGFDRWNRPRHVYADGGTALVLSRQGGFA
RLRSLVTVSEPVLEGMHRGGHPFGPPSAEEQRTVDLDAHSGRTWPRREARSASPRVSAGQ
EEALAGALKAAGVGLDDISRVVLPHMGWRRLSASYFGKWPVPPERTTWEFGRRTGHLGGG
DPIAGFDHLVGSGRLAPGELCLLVSVGAGFSWSCAVVELLDARRWAAAPAAR
selected fasta
>polyketide synthase beta-ketoacyl synthase subunit
GTGAGCACGCTGCCGGGAGCACCTGGGGACCTCTACGTGGCCGGTTGCGGTGTCTGGCTG
CCCCCGCCGGTGACCACGGATCAGGCCCTGGCCGCCGGTCACTGCGACCGCAGGCTCGCC
TCCTCGACGCGGATGCTGTCGGTGGCGGTCGCCGACAAGGAGACACCGGCGGAGATGGCG
GCCTCGGCGGCCCGGACCGCTGTGGACCGCTCCGGCGTCCCCCCGGCCCGCATCGTCCTC
GTCCTGCACGCCAGCCTGTACTTCCAGGGGCACCATCTGTGGGCTCCCGCCTCCTACGTC
CAGCGGGTGGCCCTCGGGAACCGTTGCCCCGCCATGGAGGTGCGGCAGGTGTCCAACGGC
GGCATGGCCGCCCTGGAGCTCGCCCGCGCGTACCTGCTCGCCGCCCCGGACCGGACGGCC
GCTCTCGTCACGACGGGCGACCGGATGAGTCCGCCGGGCTTCGACCGCTGGAACAGACCC
CGGCACGTGTACGCCGACGGCGGCACCGCCCTCGTACTGTCCCGGCAGGGAGGCTTCGCC
CGGCTGCGTAGCCTGGTGACGGTCTCCGAACCGGTGCTGGAGGGCATGCACCGGGGCGGA
CACCCGTTCGGCCCGCCGTCCGCGGAGGAGCAGCGGACCGTCGACCTGGACGCGCACAGC
GGGCGTACGTGGCCGAGGCGGGAGGCTCGTTCAGCGTCGCCGCGGGTCTCGGCGGGCCAG
GAGGAGGCTCTGGCCGGCGCGCTGAAGGCCGCCGGGGTCGGACTCGACGACATCAGCCGG
GTCGTGCTGCCGCACATGGGCTGGCGCAGGCTGAGCGCCTCCTACTTCGGAAAGTGGCCG
GTTCCGCCCGAGCGGACCACGTGGGAGTTCGGGCGACGGACCGGCCATCTGGGCGGCGGC
GACCCGATCGCCGGGTTCGACCACCTCGTGGGCTCCGGCCGCCTCGCCCCGGGGGAATTG
TGTCTGCTGGTCAGCGTCGGTGCCGGCTTTAGCTGGTCGTGCGCCGTCGTGGAGTTGCTG
GACGCCCGTCGGTGGGCGGCCGCCCCGGCCGCCCGGTGA
KS113..338
KS337..1014

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR013747 3-Oxoacyl-[acyl-carrier-protein (ACP)] synthase III C-terminal (Domain)
 [248-338]  4.10000000000001e-19 PF08541
PF08541   ACP_syn_III_C
IPR013751 3-Oxoacyl-[acyl-carrier-protein (ACP)] synthase III (Domain)
 [113-178]  3.1e-07 PF08545
PF08545   ACP_syn_III
IPR016038 Thiolase-like, subgroup (Domain)
 [10-169]  1.3e-19 G3DSA:3.40.47.10 [170-178]  1.2e-18 G3DSA:3.40.47.10 [211-338]  1.2e-18 G3DSA:3.40.47.10
G3DSA:3.40.47.10   Thiolase-like_subgr
IPR016039 Thiolase-like (Domain)
 [1-342]  6.09999977126211e-27 SSF53901
SSF53901   Thiolase-like
SignalP No significant hit
TMHMM No significant hit