close all open/close all

CDS information : Dauno_00190


close this sectionLocation

Organism
StrainC5
Entry nameDaunorubicin
Contig
Start / Stop / Direction15,495 / 16,511 / + [in whole cluster]
6,314 / 7,330 / + [in contig]
Location15495..16511 [in whole cluster]
6314..7330 [in contig]
TypeCDS
Length1,017 bp (338 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category1.4 Other
Productputative acyl-ACP thioesterase
Product (GenBank)acyltransferase
GenedpsD
Gene (GenBank)
EC number
Keyword
  • type II thioesterase
  • non-acetate starter unit
Note
Note (GenBank)
  • ORFD; putative
Reference
ACC
PmId
[7928998] Isolation and sequence analysis of polyketide synthase genes from the daunomycin-producing Streptomyces sp. strain C5. (J Bacteriol. , 1994)
[11162232] The product of dpsC confers starter unit fidelity upon the daunorubicin polyketide synthase of Streptomyces sp. strain C5. (Metab Eng. , 2001)
Related Reference
ACC
Q54817
NITE
Adria_00300
PmId
[7828855] Characterization of the Streptomyces peucetius ATCC 29050 genes encoding doxorubicin polyketide synthase. (Gene. , 1994)
[10419974] The Streptomyces peucetius dpsC gene determines the choice of starter unit in biosynthesis of the daunorubicin polyketide. (J Bacteriol. , 1999)
ACC
Q9F6D9
NITE
R1128_00030
PmId
[15260498] The acyltransferase homologue from the initiation module of the R1128 polyketide synthase is an acyl-ACP thioesterase that edits acetyl primer units. (Biochemistry. , 2004)
ACC
Q9KHK3
NITE
Enter_00120
PmId
[21531566] Policing starter unit selection of the enterocin type II polyketide synthase by the type II thioesterase EncL. (Bioorg Med Chem. , 2011)

close this sectionSequence

selected fasta
>putative acyl-ACP thioesterase [acyltransferase]
MDVPAILLMFPGQGSQHARMAAGLYGSEPVFTAAMDEVLAAYDAAGDCEGQRLRADWLSD
RPAVPLDHVTRSQPLLFAVDYALGRMVLATTGRPWALLGHSVGEMAGAALAGVFTLRDAA
CLLLDRVRRLAQAPPGGMLAVAAGEDVLGPYLVEGEVAVAAVNSPRQTILAGPVAPLAAV
ARALREAGLTCREVPSLTAFHSPVLAPYTTGAAERFASTRVAAPSIPLRSGYRPGAVTGR
LAADPSYWAGHPVETVRFWPALDAMLRSRTGVVCLETGPGQGLSTVARRHPTVRSGRNAV
VSLLPPRAGTAEMDRTSVAAALTAVRERGAVLSGRPGR
selected fasta
>putative acyl-ACP thioesterase [acyltransferase]
ATGGACGTGCCCGCGATTCTCCTGATGTTCCCGGGGCAGGGGTCCCAGCACGCGAGGATG
GCAGCCGGGCTGTACGGATCCGAACCGGTCTTCACCGCTGCCATGGACGAGGTCCTCGCC
GCGTACGATGCCGCCGGCGACTGTGAGGGCCAGCGGCTGCGTGCCGACTGGCTGAGCGAC
CGTCCAGCCGTGCCGCTGGACCACGTCACCCGGTCCCAGCCGCTGTTGTTCGCGGTGGAC
TACGCCCTCGGCAGGATGGTACTGGCCACGACGGGCCGGCCGTGGGCCCTGCTCGGGCAC
AGTGTCGGCGAGATGGCGGGGGCCGCGCTCGCCGGGGTGTTCACGCTGCGCGACGCGGCC
TGCCTCCTGCTGGACCGGGTGCGACGGCTGGCCCAGGCACCGCCCGGGGGGATGCTGGCG
GTCGCCGCGGGCGAGGACGTGCTGGGCCCGTATCTCGTGGAGGGGGAGGTGGCGGTCGCG
GCCGTCAACTCGCCCCGCCAGACCATCCTCGCCGGCCCCGTCGCACCGCTCGCCGCGGTC
GCCCGGGCACTGCGGGAGGCGGGGCTCACATGCCGTGAGGTGCCCTCGCTGACCGCATTC
CACAGTCCGGTGCTGGCCCCGTACACGACGGGGGCGGCCGAGCGGTTCGCATCGACGCGC
GTGGCGGCGCCGTCCATCCCTCTCCGCTCCGGGTACCGGCCGGGCGCGGTGACCGGGCGA
CTGGCCGCCGACCCGTCCTACTGGGCCGGACATCCCGTGGAGACGGTCCGCTTCTGGCCG
GCACTGGACGCGATGCTCCGCTCCCGCACGGGCGTCGTCTGCCTGGAGACCGGGCCGGGG
CAGGGGCTCAGCACCGTCGCCCGCCGCCATCCGACGGTGCGGTCGGGGAGGAACGCGGTG
GTGTCGCTGCTGCCGCCGCGGGCCGGCACCGCCGAGATGGACCGGACGTCCGTGGCGGCG
GCGCTGACCGCAGTGCGCGAGCGGGGCGCTGTGCTCAGTGGGCGACCCGGGCGGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001227 Acyl transferase domain (Domain)
 [4-132]  1.99999999999999e-41 G3DSA:3.40.366.10 [198-299]  1.99999999999999e-41 G3DSA:3.40.366.10
G3DSA:3.40.366.10   Ac_transferase_reg
IPR014043 Acyl transferase (Domain)
 [9-266]  6.49999999999992e-34 PF00698
PF00698   Acyl_transf_1
IPR016035 Acyl transferase/acyl hydrolase/lysophospholipase (Domain)
 [5-291]  3.99998544139406e-39 SSF52151
SSF52151   Acyl_Trfase/lysoPlipase
IPR016036 Malonyl-CoA ACP transacylase, ACP-binding (Domain)
 [134-195]  4.30000170645867e-11 SSF55048
SSF55048   Malonyl_transacylase_ACP-bd
SignalP No significant hit
TMHMM No significant hit