close all open/close all

CDS information : Dauno_00200


close this sectionLocation

Organism
StrainC5
Entry nameDaunorubicin
Contig
Start / Stop / Direction2,523 / 1,696 / - [in whole cluster]
674 / 1,501 / + [in contig]
Locationcomplement(1696..2523) [in whole cluster]
674..1501 [in contig]
TypeCDS
Length828 bp (275 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.2 function unknown
Productputative doxorubicin biosynthesis protein
Product (GenBank)
GenedauV
Gene (GenBank)orfA
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[8655530] Isolation and characterization of a gene from Streptomyces sp. strain C5 that confers the ability to convert daunomycin to doxorubicin on Streptomyces lividans TK24. (J Bacteriol. , 1996)
Related Reference
ACC
Q9ZAU2
NITE
Adria_00020
PmId
[9864344] Doxorubicin overproduction in Streptomyces peucetius: cloning and characterization of the dnrU ketoreductase and dnrV genes and the doxA cytochrome P-450 hydroxylase gene. (J Bacteriol. , 1999)

close this sectionSequence

selected fasta
>putative doxorubicin biosynthesis protein
MTRFAPGAPAWFDLGSPDVAASADFYTGLFGWTATVVSDPGAGGYTTFSSDGKLVAAVAR
HQIDTPYHRPYGPGNDQHGMPAIWTVYFATNDADALTKRVETAGGDVIMTPMDVLGLGRM
AVFADPSGAAFAVWRKGVMEGAEVTGVPGSVGWVELVTDDIGTARGFYRATLGLAPADTG
RKGVTDPVWHIHDTPVAGTRELGTTGAVRPHWAVLFSVHDCDATVRRAVELGGSVENEPV
DTPRGRRADLLDPHGAGFSVVELREAYPAAADGAS
selected fasta
>putative doxorubicin biosynthesis protein
GTGACCAGGTTCGCGCCCGGCGCCCCCGCATGGTTCGACCTCGGGTCGCCCGATGTCGCC
GCCTCGGCCGACTTCTACACCGGCCTCTTCGGCTGGACCGCGACCGTGGTCAGCGACCCG
GGTGCCGGGGGATACACGACGTTCAGCTCCGACGGGAAGCTGGTCGCCGCGGTCGCCCGC
CATCAGATCGACACGCCCTACCACCGTCCGTACGGGCCCGGCAACGACCAGCACGGCATG
CCGGCCATCTGGACCGTGTACTTCGCCACCAACGACGCCGACGCACTGACCAAACGGGTC
GAGACGGCGGGTGGCGACGTCATCATGACCCCGATGGACGTCCTCGGTCTCGGCCGGATG
GCGGTCTTCGCCGACCCATCGGGGGCCGCGTTCGCGGTGTGGCGCAAGGGCGTCATGGAG
GGCGCGGAGGTGACGGGCGTGCCCGGCTCGGTCGGCTGGGTGGAACTGGTGACCGACGAC
ATCGGGACCGCCCGTGGCTTCTACCGTGCGACCCTCGGCCTGGCTCCGGCCGACACCGGA
CGCAAGGGCGTCACCGACCCGGTTTGGCACATCCATGACACACCGGTCGCCGGCACCCGG
GAACTGGGCACGACCGGCGCGGTACGGCCCCACTGGGCCGTGCTGTTCTCCGTGCACGAC
TGCGACGCGACGGTCCGGCGGGCCGTCGAACTCGGCGGCTCCGTCGAGAACGAGCCCGTC
GACACCCCCAGGGGGCGGCGGGCGGACCTGCTCGACCCGCACGGGGCCGGCTTCTCGGTG
GTCGAACTGCGGGAGGCGTACCCCGCGGCGGCGGACGGTGCCTCATGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR025870 Glyoxalase-like domain (Domain)
 [15-134]  3.1e-15 PF12681 [157-259]  4.5e-11 PF12681
PF12681   Glyoxalase_2
SignalP
 [1-22]  0.307 Signal
Bacteria, Gram-positive   
 [1-10]  0.509 Signal
Bacteria, Gram-negative   
TMHMM No significant hit