close all open/close all

CDS information : Dauno_00210


close this sectionLocation

Organism
StrainC5
Entry nameDaunorubicin
Contig
Start / Stop / Direction1,699 / 431 / - [in whole cluster]
1,498 / 2,766 / + [in contig]
Locationcomplement(431..1699) [in whole cluster]
1498..2766 [in contig]
TypeCDS
Length1,269 bp (422 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.3 modification reduction
Productcytochrome P450
Product (GenBank)daunomycin C-14 hydroxylase
Gene
Gene (GenBank)doxA
EC number
Keyword
  • C-13 hydroxylate
  • C-13 OH group oxidation
  • C-14 hydroxylate
Note
Note (GenBank)
Reference
ACC
PmId
[8655530] Isolation and characterization of a gene from Streptomyces sp. strain C5 that confers the ability to convert daunomycin to doxorubicin on Streptomyces lividans TK24. (J Bacteriol. , 1996)
[9098063] In vivo and in vitro bioconversion of epsilon-rhodomycinone glycoside to doxorubicin: functions of DauP, DauK, and DoxA. (J Bacteriol. , 1997)
[9864343] Purification, properties, and characterization of recombinant Streptomyces sp. strain C5 DoxA, a cytochrome P-450 catalyzing multiple steps in doxorubicin biosynthesis. (J Bacteriol. , 1999)
Related Reference
ACC
Q9ZAU3
NITE
Adria_00010
PmId
[9864344] Doxorubicin overproduction in Streptomyces peucetius: cloning and characterization of the dnrU ketoreductase and dnrV genes and the doxA cytochrome P-450 hydroxylase gene. (J Bacteriol. , 1999)
ACC
Q93MI2
PmId
[26334717] Understanding of real alternative redox partner of Streptomyces peucetius DoxA: Prediction and validation using in silico and in vitro analyses. (Arch Biochem Biophys. , 2015)

close this sectionSequence

selected fasta
>cytochrome P450 [daunomycin C-14 hydroxylase]
MSGEAPRVAVDPFSCPMMTMQRKPEVHDAFREAGPVVEVNAPAGGPAWVITDDALAREVL
ADPRFVKDPDLAPTAWRGVDDGLDIPVPELRPFTLIAVDGEDHRRLRRIHAPAFNPRRLA
ERTDRIAAIADRLLTELADSSDRSGEPAELIGGFAYHFPLLVICELLGVPVTDPAMAREA
VGVLKALGLGGPQSAGGDGTDPAGDVPDTSALESLLLEAVHAARRKDTRTMTRVLYERAQ
AEFGSVSDDQLVYMITGLIFAGHDTTGSFLGFLLAEVLAGRLAADADGDAISRFVEEALR
HHPPVPYTLWRFAATEVVIRGVRLPRGAPVLVDIEGTNTDGRHHDAPHAFHPDRPSRRRL
TFGDGPHYCIGEQLAQLESRTMIGVLRSRFPQARLAVPYEELRWCRKGAQTARLTDLPVW
LR
selected fasta
>cytochrome P450 [daunomycin C-14 hydroxylase]
ATGAGCGGCGAGGCGCCGCGGGTGGCCGTCGACCCGTTCTCGTGTCCCATGATGACCATG
CAGCGCAAACCCGAGGTGCACGACGCATTCCGAGAGGCGGGCCCCGTCGTCGAGGTGAAC
GCCCCCGCGGGCGGACCCGCCTGGGTCATCACCGATGACGCCCTCGCCCGCGAGGTGCTG
GCCGATCCCCGGTTCGTGAAGGACCCCGATCTCGCGCCCACCGCCTGGCGGGGGGTGGAC
GACGGTCTCGACATCCCCGTTCCGGAGCTGCGTCCGTTCACGCTCATCGCCGTGGACGGT
GAGGACCACCGGCGTCTGCGCCGCATCCACGCACCGGCGTTCAACCCGCGCCGGCTGGCC
GAGCGGACGGATCGCATCGCCGCCATCGCCGACCGGCTGCTCACCGAACTCGCCGACTCC
TCCGACCGGTCGGGCGAACCGGCCGAGCTGATCGGCGGCTTCGCGTACCACTTCCCGCTG
TTGGTCATCTGCGAACTGCTCGGCGTGCCGGTCACCGATCCGGCAATGGCCCGCGAGGCC
GTCGGCGTGCTCAAGGCACTCGGCCTCGGCGGCCCGCAGAGCGCCGGCGGTGACGGCACG
GACCCTGCCGGGGACGTGCCGGACACGTCGGCGCTGGAGAGCCTTCTCCTCGAAGCCGTG
CACGCGGCCCGGCGGAAAGACACCCGGACCATGACCCGCGTGCTCTATGAACGCGCACAG
GCAGAGTTCGGCTCGGTCTCCGACGACCAGCTCGTCTACATGATCACCGGACTCATCTTC
GCCGGCCACGACACCACCGGCTCGTTCCTGGGCTTCCTGCTTGCGGAGGTCCTGGCGGGC
CGTCTCGCGGCGGACGCCGACGGGGACGCCATCTCCCGGTTCGTGGAGGAGGCGCTGCGC
CACCACCCGCCGGTGCCCTACACGTTGTGGAGGTTCGCTGCCACGGAGGTGGTCATCCGC
GGTGTCCGGCTGCCCCGCGGAGCGCCGGTACTGGTGGACATCGAGGGCACCAACACCGAC
GGCCGCCATCACGACGCCCCGCACGCTTTCCACCCGGACCGCCCTTCGAGGCGGCGGCTC
ACCTTCGGCGACGGGCCGCACTACTGCATCGGGGAGCAGCTCGCCCAGCTGGAATCGCGC
ACGATGATCGGCGTACTGCGCAGCAGGTTCCCCCAAGCCCGACTGGCCGTGCCGTACGAG
GAGTTGCGGTGGTGCAGGAAGGGGGCCCAGACAGCGCGGCTCACTGACCTGCCCGTCTGG
CTGCGTTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001128 Cytochrome P450 (Family)
 [261-278]  1.40000045763982e-07 PR00385 [293-304]  1.40000045763982e-07 PR00385 [360-369]  1.40000045763982e-07 PR00385 [369-380]  1.40000045763982e-07 PR00385
PR00385   P450
 [11-421]  1.39999277195148e-68 SSF48264
SSF48264   Cytochrome_P450
 [24-420]  1e-74 G3DSA:1.10.630.10
G3DSA:1.10.630.10   Cyt_P450
 [294-389]  8.1e-17 PF00067
PF00067   p450
IPR002397 Cytochrome P450, B-class (Family)
 [98-109]  3.69999438558106e-26 PR00359 [149-165]  3.69999438558106e-26 PR00359 [166-181]  3.69999438558106e-26 PR00359 [293-304]  3.69999438558106e-26 PR00359 [311-338]  3.69999438558106e-26 PR00359 [360-369]  3.69999438558106e-26 PR00359 [369-380]  3.69999438558106e-26 PR00359
PR00359   BP450
IPR017972 Cytochrome P450, conserved site (Conserved_site)
 [362-371]  PS00086
PS00086   CYTOCHROME_P450
SignalP No significant hit
TMHMM No significant hit