close all open/close all
first first   Dauno_00210 Dauno_00210

CDS information : Dauno_00220


close this sectionLocation

Organism
StrainC5
Entry nameDaunorubicin
Contig
Start / Stop / Direction147 / 1 / - [in whole cluster]
3,050 / 3,196 / + [in contig]
Locationcomplement(1..147) [in whole cluster]
3050..3196 [in contig]
TypeCDS
Length147 bp (48 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category4.1 transcriptional regulator
Productputative transcriptional regulator(fragment)
Product (GenBank)DauI
Gene
Gene (GenBank)dauI
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[8655530] Isolation and characterization of a gene from Streptomyces sp. strain C5 that confers the ability to convert daunomycin to doxorubicin on Streptomyces lividans TK24. (J Bacteriol. , 1996)
[7928998] Isolation and sequence analysis of polyketide synthase genes from the daunomycin-producing Streptomyces sp. strain C5. (J Bacteriol. , 1994)
[9098068] Minimal Streptomyces sp. strain C5 daunorubicin polyketide biosynthesis genes required for aklanonic acid biosynthesis. (J Bacteriol. , 1997)
Related Reference
ACC
P25047
NITE
Adria_00210
PmId
[1729206] Regulation of secondary metabolism in Streptomyces spp. and overproduction of daunorubicin in Streptomyces peucetius. (J Bacteriol. , 1992)
[7868593] Functional characterization and transcriptional analysis of the dnrR1 locus, which controls daunorubicin biosynthesis in Streptomyces peucetius. (J Bacteriol. , 1995)
[8971703] Purification and characterization of the DNA-binding protein DnrI, a transcriptional factor of daunorubicin biosynthesis in Streptomyces peucetius. (Mol Microbiol. , 1996)
[16545946] Feedback regulation of doxorubicin biosynthesis in Streptomyces peucetius. (Res Microbiol. , 2006)
[20529134] Modulation of dnrN expression by intracellular levels of DnrO and daunorubicin in Streptomyces peucetius. (FEMS Microbiol Lett. , 2010)
[20158521] Daunorubicin efflux in Streptomyces peucetius modulates biosynthesis by feedback regulation. (FEMS Microbiol Lett. , 2010)

close this sectionSequence

selected fasta
>putative transcriptional regulator(fragment) [DauI]
MQINMLGPLVAHHNGTSVTPIARKPRQVFSLLALQAGTVVPVPALMEEL
selected fasta
>putative transcriptional regulator(fragment) [DauI]
ATGCAGATCAATATGTTGGGCCCGCTCGTTGCACATCACAATGGCACGTCGGTGACCCCG
ATAGCCAGAAAACCCCGGCAGGTATTCTCACTGCTCGCTCTTCAGGCAGGAACCGTCGTT
CCGGTCCCCGCGCTGATGGAGGAGCTC

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001867 Signal transduction response regulator, C-terminal (Domain)
 [19-49]  4.6e-05 PF00486
PF00486   Trans_reg_C
SignalP
 [1-36]  0.143 Signal
Bacteria, Gram-negative   
TMHMM No significant hit
first first   Dauno_00210 Dauno_00210