close all open/close all
first first   Dynm_00010 Dynm_00010

CDS information : Dynm_00005


close this sectionLocation

Organism
StrainATCC 53710 (=NBRC 15963)
Entry nameDynemicin
Contig
Start / Stop / Direction14 / 2,110 / + [in whole cluster]
14 / 2,110 / + [in contig]
Location14..2110 [in whole cluster]
14..2110 [in contig]
TypeCDS
Length2,097 bp (698 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.4 hypothetical protein
Producthypothetical protein
Product (GenBank)
Gene
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)
Reference
PmId
[18328078] The biosynthetic genes encoding for the production of the dynemicin enediyne core in Micromonospora chersina ATCC53710. (FEMS Microbiol Lett. , 2008)

close this sectionSequence

selected fasta
>hypothetical protein
MLWRAQIASRGFLAADDYVMITQASESDLTGGYLLSLYNNHFMPAGRLIIWLVTSAFGLT
YWPYVLLMAVGQAVLSVAFYRLLRTLLRPSRLLLVPLGLLLFSPLTLEATSWWAVGANML
PMQLAMVLALGSQLKYVRTGRKRHLVSLVLSVLLGLLFFEKALLVVPLVFLFTACFLTDG
GPVRAALTTLRRWWPSWLALTTLVAAFFGVYLLRSESSLRRPESIGEVVSFLSQLIGSTL
VPGLLGGPWGWLGAGDGAPVVAPPELGRWIAWTFMAALVVFTVRRDRTAGRSWALLSGYL
VLVAVLLASTRLGSVYSGVAGGVPRYVSDVVVVAAICIGVALVGIARPVPAGSAPAAPAE
PAPPTDPVSAVEPEPARQPEPVAPRRPVAALSSRVGVIHAETPYDPEIEPAGQLEPEPTP
EPGPASLGPEPAPETTSEAGSTSAVDDGSVARPAPGPDTAEPGPREPAPPPPDWLAGVPE
RYREVVTAGLVLVLLAAMLGTAWTTSRYSDEWALKFGRSYLDTARIELASAPPDTVFFDT
PIPPAVIPELSWPYNLQSRFFAAAGARPVFVHETENASVLDGLGRVQVATIEGSSIRPGP
QEGCGYLVGDGQTVRMPLDKPRDDWFWIVRIGYLSSSDGTAVLRLGQGSHEFPVKKGLNQ
RFFEISGGGDAVELTVSGPAISLCTNEISIGNPIPKPE
selected fasta
>hypothetical protein
GTGCTCTGGCGGGCGCAGATCGCCTCCCGCGGTTTCCTGGCGGCCGACGACTACGTGATG
ATCACGCAGGCGTCCGAGTCCGACCTCACCGGCGGCTACCTGCTCAGCCTGTACAACAAC
CACTTCATGCCGGCCGGGCGGCTGATCATCTGGCTGGTCACCAGCGCCTTCGGCCTCACC
TACTGGCCGTACGTGCTGCTGATGGCGGTCGGCCAGGCGGTGCTCAGCGTGGCCTTCTAC
CGGTTGCTGCGTACATTGCTGCGGCCGAGCCGGCTGCTGCTGGTTCCGCTCGGGCTGTTG
CTGTTCAGCCCGCTGACCCTGGAGGCAACGTCCTGGTGGGCGGTCGGCGCGAACATGCTG
CCGATGCAGCTGGCCATGGTGCTCGCCCTCGGATCGCAGCTGAAGTACGTGCGCACCGGG
CGGAAGCGGCATCTGGTGTCGCTGGTCCTCTCCGTGCTGCTCGGCCTGCTCTTCTTCGAG
AAGGCGCTGCTTGTCGTGCCGCTGGTCTTTCTCTTCACCGCGTGCTTCCTCACCGACGGC
GGCCCGGTACGCGCGGCGCTGACCACGCTGCGCCGGTGGTGGCCGTCCTGGCTGGCACTC
ACCACCCTCGTGGCCGCCTTTTTCGGGGTCTATCTGCTCCGGTCGGAGTCGTCCCTGCGC
CGACCGGAGTCCATCGGCGAGGTCGTCTCGTTCCTGTCCCAGCTGATCGGCTCCACCCTC
GTGCCGGGGCTGCTCGGCGGCCCGTGGGGCTGGCTGGGAGCTGGTGACGGCGCGCCGGTG
GTGGCCCCGCCGGAACTCGGCCGGTGGATCGCCTGGACGTTCATGGCCGCTCTGGTGGTG
TTCACCGTGCGGCGGGACCGCACGGCCGGCCGGTCCTGGGCTCTGCTGAGCGGGTACCTG
GTCCTGGTCGCCGTGCTGCTGGCGTCGACCCGGTTGGGCTCGGTCTACAGCGGGGTGGCC
GGCGGCGTGCCCCGGTACGTCAGCGACGTTGTGGTGGTAGCGGCGATCTGCATCGGCGTC
GCGCTGGTCGGCATCGCCCGACCGGTACCGGCCGGGTCCGCGCCGGCCGCGCCCGCCGAA
CCGGCTCCGCCGACGGATCCGGTGTCGGCCGTCGAGCCGGAGCCGGCACGGCAGCCGGAA
CCGGTCGCCCCGCGCCGACCGGTTGCCGCCTTGTCCTCCCGGGTCGGCGTCATCCATGCC
GAGACGCCGTACGACCCGGAGATCGAACCGGCCGGGCAGCTTGAACCCGAGCCGACCCCC
GAGCCGGGGCCGGCGTCCCTGGGGCCGGAGCCGGCACCCGAGACCACCAGCGAGGCCGGC
AGCACCTCGGCGGTCGACGACGGATCGGTCGCCCGGCCCGCGCCGGGTCCCGACACCGCA
GAACCGGGGCCGCGGGAGCCGGCTCCCCCGCCGCCCGACTGGCTGGCCGGAGTACCCGAG
CGGTACCGGGAGGTGGTCACCGCGGGTCTGGTGCTGGTCCTGCTGGCCGCGATGTTGGGC
ACCGCCTGGACCACGTCCCGCTACAGCGACGAGTGGGCGCTCAAGTTCGGCCGGTCCTAC
CTGGACACGGCCCGGATCGAGCTGGCCAGCGCCCCACCCGACACCGTCTTCTTCGACACC
CCGATCCCGCCGGCCGTGATCCCGGAGCTCTCCTGGCCGTACAACCTCCAGTCCCGCTTC
TTCGCGGCGGCCGGCGCCCGGCCGGTGTTCGTGCACGAGACGGAGAACGCCTCCGTGCTG
GACGGCCTCGGCCGCGTGCAGGTGGCCACCATCGAAGGCAGCAGCATCCGGCCGGGCCCG
CAGGAGGGCTGCGGCTACCTGGTCGGCGACGGGCAGACCGTCCGGATGCCGCTGGACAAG
CCACGCGACGACTGGTTCTGGATCGTCCGGATCGGCTACCTGAGTTCCAGCGACGGCACC
GCTGTGCTGCGGCTCGGCCAGGGCAGCCACGAGTTCCCGGTCAAGAAGGGGCTGAACCAG
CGATTCTTCGAGATCAGCGGGGGCGGGGACGCCGTCGAGCTGACCGTGAGCGGCCCGGCC
ATCAGCCTCTGCACGAACGAGATCTCGATCGGCAACCCGATCCCGAAGCCGGAGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
No significant hit
SignalP No significant hit
TMHMM
 [48-70]  Transmembrane (i-o) [109-131]  Transmembrane (o-i) [144-178]  Transmembrane (i-o) [193-215]  Transmembrane (o-i) [228-250]  Transmembrane (i-o) [265-283]  Transmembrane (o-i) [290-312]  Transmembrane (i-o) [327-346]  Transmembrane (o-i) [485-507]  Transmembrane (i-o)
Transmembrane 9   
first first   Dynm_00010 Dynm_00010