close all open/close all

CDS information : Dynm_00020


close this sectionLocation

Organism
StrainATCC 53710 (=NBRC 15963)
Entry nameDynemicin
Contig
Start / Stop / Direction4,284 / 3,364 / - [in whole cluster]
4,284 / 3,364 / - [in contig]
Locationcomplement(3364..4284) [in whole cluster]
complement(3364..4284) [in contig]
TypeCDS
Length921 bp (306 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.1 general function
Productputative NUDIX hydrolase
Product (GenBank)NTP pyrophosphohydrolase
Gene
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)
  • ORF3; contains putative nucleic-acid-binding-like Zn-finger
Reference
ACC
PmId
[18328078] The biosynthetic genes encoding for the production of the dynemicin enediyne core in Micromonospora chersina ATCC53710. (FEMS Microbiol Lett. , 2008)
Related Reference
ACC
Q9BQG2
PmId
[12790796] Mammalian NADH diphosphatases of the Nudix family: cloning and characterization of the human peroxisomal NUDT12 protein. (Biochem J. , 2003)
Family/Domain
FD
IPR000086

close this sectionSequence

selected fasta
>putative NUDIX hydrolase [NTP pyrophosphohydrolase]
MRTDERTLAYGGGWLDRAAALRADPAWIAARLSDPESVLLPLWRDRCLVSADRVPVRRSA
GAAGLRAAADETVFLGLDAGRAVFAVDLSGRGDAEACELAGAAEAVDVRALVGGLGAAEA
AVQAYAKGLLHWHRGQRFCGGCGAATVAGDGGHTRSCTGAGCGRLLFPRIEPAVIVLVEA
PGEPERCLLARHRGASEDSWSTLAGFVEIGESLEDAVRRELAEEAGVTVAGVAYQGSQAW
PFPAGLMVGFRATAASTEVRVDGEEVVEARWFSRAELRERLAAGRPLGRIDSIDHHLLHS
WLAAGD
selected fasta
>putative NUDIX hydrolase [NTP pyrophosphohydrolase]
GTGCGGACGGATGAGCGGACCCTGGCGTACGGCGGTGGCTGGCTGGACCGGGCTGCGGCG
CTGCGCGCCGACCCGGCGTGGATCGCCGCGCGGCTGAGCGATCCGGAGAGCGTGCTGCTG
CCGCTGTGGCGGGACCGCTGCCTGGTGTCGGCCGACCGGGTGCCGGTGCGCCGCTCCGCC
GGGGCGGCCGGGCTGCGCGCCGCCGCCGACGAGACGGTGTTCCTCGGCCTGGACGCCGGC
CGGGCGGTGTTCGCCGTGGACCTCTCCGGCCGGGGCGACGCCGAGGCGTGCGAGCTGGCC
GGCGCGGCCGAGGCGGTGGACGTCCGCGCGCTGGTGGGCGGGCTGGGGGCGGCCGAGGCG
GCCGTCCAGGCGTACGCCAAGGGGTTGCTGCACTGGCACCGCGGCCAGCGGTTCTGCGGC
GGGTGCGGTGCGGCGACGGTGGCCGGCGACGGTGGCCACACCCGGTCCTGCACCGGCGCC
GGCTGCGGGCGGCTGCTCTTCCCCCGGATCGAGCCGGCGGTCATCGTGCTGGTCGAGGCG
CCCGGTGAGCCGGAGCGCTGCCTGCTGGCCCGGCACCGGGGAGCGTCCGAGGACTCCTGG
TCGACCCTGGCGGGCTTCGTGGAGATCGGCGAGAGCCTGGAGGACGCGGTGCGCCGGGAG
CTGGCCGAGGAGGCCGGGGTGACCGTGGCCGGCGTGGCGTACCAGGGGTCGCAGGCGTGG
CCCTTCCCGGCCGGGCTGATGGTCGGCTTCCGCGCGACGGCCGCGTCAACCGAGGTGCGG
GTGGACGGCGAGGAGGTGGTGGAGGCGCGCTGGTTCAGCCGGGCGGAGCTGCGGGAGCGG
CTGGCGGCGGGTCGGCCGCTGGGCCGGATCGACTCGATCGACCACCACCTGCTGCACAGC
TGGCTGGCCGCTGGCGACTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000086 NUDIX hydrolase domain (Domain)
 [124-303]  9.50000000000005e-38 G3DSA:3.90.79.10
G3DSA:3.90.79.10   NUDIX_hydrolase
 [172-285]  4.10000000000001e-17 PF00293
PF00293   NUDIX
 [168-294]  PS51462
PS51462   NUDIX
IPR015375 NADH pyrophosphatase-like, N-terminal (Domain)
 [37-132]  2.2e-12 PF09296
PF09296   NUDIX-like
IPR015376 Zinc ribbon, NADH pyrophosphatase (Domain)
 [136-165]  3.4e-05 PF09297
PF09297   zf-NADH-PPase
IPR015797 NUDIX hydrolase domain-like (Domain)
 [117-302]  1.70000295590053e-37 SSF55811
SSF55811   NUDIX_hydrolase
IPR020084 NUDIX hydrolase, conserved site (Conserved_site)
 [205-226]  PS00893
PS00893   NUDIX_BOX
IPR020476 NUDIX hydrolase (Domain)
 [200-214]  3.69999844802221e-05 PR00502 [214-229]  3.69999844802221e-05 PR00502
PR00502   NUDIXFAMILY
SignalP No significant hit
TMHMM No significant hit