close all open/close all

CDS information : Dynm_00030


close this sectionLocation

Organism
StrainATCC 53710 (=NBRC 15963)
Entry nameDynemicin
Contig
Start / Stop / Direction4,478 / 6,295 / + [in whole cluster]
4,478 / 6,295 / + [in contig]
Location4478..6295 [in whole cluster]
4478..6295 [in contig]
TypeCDS
Length1,818 bp (605 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.4 hypothetical protein
Producthypothetical protein
Product (GenBank)hypothetical protein
Gene
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)
  • ORF4
Reference
ACC
PmId
[18328078] The biosynthetic genes encoding for the production of the dynemicin enediyne core in Micromonospora chersina ATCC53710. (FEMS Microbiol Lett. , 2008)

close this sectionSequence

selected fasta
>hypothetical protein [hypothetical protein]
MTLYGEKVPSADDRPTVKVTAVSWPDVEMEPVAAPDAGGTGKSGRSRRGRLLLAGGIVAA
VLAAGTGLGTYAYAGDVPRGTTVLGAELGGRSRAEAARALRAELERREAALNAPVTVTVG
QKTAELKPADIGLAVDVDATVAAAAAAEAHPVSRLVGSRTVDPVVTVDTARLESVLRKAM
GDQGREMTMPAIIYTGTTPKPVYPKPALTVDAPGAAHAVKAGWLAGAPVAVPLVEKWPAS
TREEVDRLVAELARPAVAAPVTLTTDGGSVTIPPAAIARGLRFSADDTGKLTPRVDVKRL
RTALGDQLAKLEVAPKDAGLTISGGKPKVVPSRAGRQVDAAALGRDLLAVLPKADGRTVT
AALKPAEPELTEAKLAELGIKERVSTFTTRFPGGLSSPRSQNIVQAAKDVDGTIVRPGET
FSLNGHTGERGYDQGYKDAPTIVNGKLVPGVGGGVSQFTTTLFNASYYAGLEDVEHKPHS
FYFSRYPAVIESTIYWPQLDFKFRNNTPYGVLIDTSYTSSTITVSMWSTKIYDSVKTEYG
PRRDITQPKTVYLDPGPDCIAAAGSVGFAQDAYRVIKKDGKVVKREKFSWRYDPEPRFIC
AKPPA
selected fasta
>hypothetical protein [hypothetical protein]
GTGACGCTCTACGGCGAAAAAGTGCCTTCCGCCGACGACCGGCCCACCGTGAAGGTGACA
GCGGTGAGCTGGCCGGACGTCGAGATGGAACCGGTCGCCGCCCCCGACGCCGGCGGGACC
GGGAAGTCGGGGCGGTCCCGGCGCGGGCGGCTGCTGCTCGCCGGCGGGATCGTCGCCGCG
GTGCTGGCCGCCGGCACCGGTCTCGGCACCTACGCGTACGCCGGCGACGTGCCCCGGGGC
ACCACGGTCCTCGGCGCCGAGCTGGGCGGGCGGAGCCGGGCCGAGGCGGCCCGGGCGCTC
CGTGCCGAGCTGGAGCGCCGGGAGGCGGCGCTGAACGCCCCGGTCACCGTCACGGTGGGC
CAGAAGACCGCCGAGCTGAAGCCGGCCGACATCGGGCTCGCCGTCGACGTGGACGCCACC
GTGGCGGCGGCCGCCGCCGCCGAGGCACACCCGGTGAGCCGCCTCGTCGGCTCCCGCACT
GTCGATCCGGTGGTCACCGTCGACACCGCCCGGCTGGAGTCGGTGCTGCGCAAGGCCATG
GGTGACCAGGGCCGCGAGATGACCATGCCGGCCATCATCTACACCGGCACCACCCCCAAG
CCGGTCTACCCGAAGCCGGCGCTGACCGTCGACGCGCCCGGCGCCGCCCACGCGGTGAAG
GCCGGCTGGCTGGCCGGCGCGCCGGTGGCCGTGCCGCTTGTCGAGAAGTGGCCGGCGAGC
ACCCGCGAGGAGGTCGACCGGCTCGTCGCGGAGCTGGCCCGGCCGGCCGTCGCGGCCCCG
GTCACGCTCACCACCGACGGCGGCTCGGTCACCATCCCGCCCGCCGCCATCGCCCGGGGG
CTGCGCTTCTCGGCCGACGACACCGGCAAGCTGACTCCCCGCGTCGACGTCAAGCGGCTG
CGGACCGCCCTCGGCGACCAGCTCGCGAAGCTCGAGGTCGCGCCGAAGGACGCCGGGCTG
ACCATCAGCGGCGGCAAGCCGAAGGTGGTGCCGAGCCGGGCCGGCCGGCAGGTCGACGCC
GCGGCGCTCGGCCGGGACCTGCTCGCCGTCCTGCCGAAGGCGGACGGCCGCACGGTGACC
GCCGCGCTGAAGCCGGCGGAGCCGGAGCTGACCGAGGCGAAGCTCGCCGAGCTGGGCATC
AAGGAGCGGGTCTCCACCTTCACCACCCGGTTCCCCGGCGGCCTGTCCTCGCCGCGCAGC
CAGAACATCGTCCAGGCCGCCAAGGACGTGGACGGCACCATCGTGCGGCCGGGAGAGACC
TTCTCGCTCAACGGCCACACCGGCGAGCGCGGCTACGACCAGGGCTACAAGGACGCGCCG
ACGATCGTGAACGGCAAGCTGGTGCCGGGCGTGGGCGGTGGCGTCTCGCAGTTCACCACC
ACGCTCTTCAACGCCAGCTATTACGCGGGCCTGGAGGACGTCGAGCACAAGCCGCACTCG
TTCTACTTCAGCCGCTATCCCGCGGTCATCGAGTCGACCATCTACTGGCCGCAACTGGAC
TTCAAGTTCCGCAACAACACCCCGTACGGCGTCCTGATCGACACCTCCTACACGTCGAGC
ACGATCACCGTGTCGATGTGGAGCACCAAGATCTACGACAGCGTCAAGACCGAGTACGGC
CCGCGCCGGGACATCACCCAGCCCAAGACGGTCTACCTGGATCCCGGCCCGGACTGCATC
GCCGCCGCGGGCAGCGTCGGCTTCGCCCAGGACGCCTACCGGGTCATCAAGAAGGACGGC
AAGGTGGTGAAGCGGGAGAAGTTCAGCTGGCGCTACGACCCCGAGCCGCGCTTCATCTGC
GCCAAGCCGCCCGCCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR007391 Vancomycin resistance VanW (Family)
 [399-528]  1.9e-46 PF04294
PF04294   VanW
IPR022029 Putative peptidoglycan binding domain (Domain)
 [252-353]  2.6e-11 PF12229
PF12229   PG_binding_4
SignalP No significant hit
TMHMM
 [51-73]  Transmembrane (i-o)
Transmembrane 1