close all open/close all

CDS information : Dynm_00050


close this sectionLocation

Organism
StrainATCC 53710 (=NBRC 15963)
Entry nameDynemicin
Contig
Start / Stop / Direction13,044 / 13,523 / + [in whole cluster]
13,044 / 13,523 / + [in contig]
Location13044..13523 [in whole cluster]
13044..13523 [in contig]
TypeCDS
Length480 bp (159 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.4 hypothetical protein
Producthypothetical protein
Product (GenBank)GntT-like protein
Gene
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)
  • ORF6
Reference
ACC
PmId
[18328078] The biosynthetic genes encoding for the production of the dynemicin enediyne core in Micromonospora chersina ATCC53710. (FEMS Microbiol Lett. , 2008)

close this sectionSequence

selected fasta
>hypothetical protein [GntT-like protein]
MIVKSRGSVPRHTITAGLSSLLRGAAGASPQAVGRRREASQPRTPSTPTVVPMAREAAMS
RACTHRKLVGLPSPTVPADHARGSFQMATANLGQITQVQTPTPTRNSDQPRDNTMAGQYA
SGPSAQVRSAGTGACGRSASSAAPGLAECCAATPTGPPR
selected fasta
>hypothetical protein [GntT-like protein]
TTGATCGTCAAATCCAGGGGTAGCGTCCCGCGTCACACCATCACCGCCGGGCTATCTTCC
CTGCTCAGAGGGGCTGCGGGCGCGAGCCCTCAGGCGGTCGGCCGGCGGCGGGAGGCCAGC
CAGCCCCGGACACCGAGCACCCCTACCGTCGTGCCGATGGCCAGGGAGGCCGCGATGAGC
AGGGCGTGCACCCACAGGAAGCTGGTGGGGCTGCCCTCGCCGACCGTGCCGGCCGACCAC
GCCCGCGGGTCGTTCCAGATGGCGACCGCGAACCTCGGCCAGATCACCCAGGTCCAGACT
CCGACCCCGACCAGGAACAGCGACCAGCCACGCGACAACACCATGGCTGGCCAGTATGCC
AGCGGCCCGTCGGCCCAGGTCAGGAGCGCGGGGACCGGAGCGTGCGGAAGGTCAGCGAGT
AGCGCAGCGCCGGGACTGGCGGAATGCTGTGCTGCCACGCCGACCGGGCCGCCCCGGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro No significant hit
SignalP No significant hit
TMHMM No significant hit