close all open/close all

CDS information : Dynm_00060


close this sectionLocation

Organism
StrainATCC 53710 (=NBRC 15963)
Entry nameDynemicin
Contig
Start / Stop / Direction13,773 / 13,423 / - [in whole cluster]
13,773 / 13,423 / - [in contig]
Locationcomplement(13423..13773) [in whole cluster]
complement(13423..13773) [in contig]
TypeCDS
Length351 bp (116 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.1 general function
Productputative oxidoreductase
Product (GenBank)TobX-like protein
Gene
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)
  • ORF7
Reference
ACC
PmId
[18328078] The biosynthetic genes encoding for the production of the dynemicin enediyne core in Micromonospora chersina ATCC53710. (FEMS Microbiol Lett. , 2008)
Family/Domain
FD
IPR005123

close this sectionSequence

selected fasta
>putative oxidoreductase [TobX-like protein]
MALCGVRERCAALAGVDPEALAQTLVTRYPPDSVIGWHRDAPAFGPTVVGLSLGSACLLR
FQRSTGENRRVYELELSPRSGYVLTGAARSAWQHSIPPVPALRYSLTFRTLRSPRS
selected fasta
>putative oxidoreductase [TobX-like protein]
GTGGCGCTGTGCGGGGTGCGCGAGCGCTGCGCGGCGCTCGCCGGTGTCGACCCCGAGGCG
CTCGCCCAGACCCTTGTCACCCGCTATCCGCCGGACTCCGTCATCGGCTGGCACCGCGAC
GCGCCCGCCTTCGGGCCGACAGTCGTCGGCCTCTCGCTGGGCTCCGCGTGCCTGTTGCGC
TTCCAGCGCTCCACCGGGGAGAACCGCCGGGTGTACGAGCTGGAGCTGTCGCCCCGCTCC
GGGTACGTGCTCACCGGGGCGGCCCGGTCGGCGTGGCAGCACAGCATTCCGCCAGTCCCG
GCGCTGCGCTACTCGCTGACCTTCCGCACGCTCCGGTCCCCGCGCTCCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR005123 Oxoglutarate/iron-dependent dioxygenase (Domain)
 [5-109]  6.1e-19 PF13532
PF13532   2OG-FeII_Oxy_2
 [20-112]  PS51471
PS51471   FE2OG_OXY
SignalP No significant hit
TMHMM No significant hit