close all open/close all

CDS information : Dynm_00090


close this sectionLocation

Organism
StrainATCC 53710 (=NBRC 15963)
Entry nameDynemicin
Contig
Start / Stop / Direction15,598 / 16,656 / + [in whole cluster]
15,598 / 16,656 / + [in contig]
Location15598..16656 [in whole cluster]
15598..16656 [in contig]
TypeCDS
Length1,059 bp (352 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.1 general function
Productputative tryptophanyl-tRNA synthetase
Product (GenBank)putative tryptophanyl-tRNA synthetase
Geneorf10
trpS2
Gene (GenBank)
EC number6.1.1.2
Keyword
Note
Note (GenBank)
  • ORF10
Reference
ACC
PmId
[18328078] The biosynthetic genes encoding for the production of the dynemicin enediyne core in Micromonospora chersina ATCC53710. (FEMS Microbiol Lett. , 2008)
Related Reference
ACC
Q9RVD6
PmId
[15520379] An unusual tryptophanyl tRNA synthetase interacts with nitric oxide synthase in Deinococcus radiodurans. (Proc Natl Acad Sci U S A. , 2004)

close this sectionSequence

selected fasta
>putative tryptophanyl-tRNA synthetase [putative tryptophanyl-tRNA synthetase]
MSAARMLTGDRPTGRLHLGHYVGSIANRVKLHQHYESFFIIADLHMLTTRNSREDIEQVS
HNAREMVTDILAAGVEPDRATFYLQSAIPEVGDLNTLFQNLVTVPRLERVPSLKEMSRDA
GKEEMPYGLLGYPVLQAADILCVKGQVVPVGKDNAAHVEVTREIARRFNHLYGEVFPVPE
MIMSETPTLVGTDGAGKMSKSKGNAIALSDDPATVRRKVLGMYTDPNRVRADVPGTVEGN
PVFAYLDVFHTDRATVEELKARYRAGRVGDVEVKEELVGALNRFLDPVRERRARFEGQRG
LVDELIVEGTERTRAQVRRTLVEVRRAMGLTSAYTQVRRRAERYRKAVGTPA
selected fasta
>putative tryptophanyl-tRNA synthetase [putative tryptophanyl-tRNA synthetase]
ATGTCCGCAGCACGGATGCTCACCGGTGACCGCCCGACCGGGCGGCTGCACCTCGGCCAC
TACGTCGGCAGCATCGCCAACCGGGTGAAGCTGCACCAGCACTACGAGAGCTTCTTCATC
ATCGCCGACCTGCACATGCTCACCACGCGCAACAGTCGCGAGGACATCGAGCAGGTCTCC
CACAACGCCCGCGAGATGGTCACCGACATCCTCGCCGCCGGTGTCGAACCGGACCGGGCC
ACCTTCTACCTCCAGTCGGCGATCCCCGAGGTCGGCGACCTGAACACCCTGTTCCAGAAC
CTGGTCACCGTGCCCCGGCTGGAACGGGTCCCGTCGCTCAAGGAGATGAGCCGGGACGCC
GGCAAGGAGGAGATGCCGTACGGGCTGCTCGGCTATCCCGTCCTCCAGGCCGCCGACATC
CTCTGCGTGAAGGGGCAGGTCGTCCCGGTGGGGAAGGACAACGCCGCGCACGTCGAGGTG
ACCCGGGAGATCGCCCGGCGCTTCAACCACCTCTACGGCGAGGTCTTCCCCGTGCCGGAA
ATGATCATGTCGGAGACGCCCACCCTGGTCGGCACCGACGGCGCGGGGAAGATGAGCAAG
AGCAAGGGAAACGCCATCGCGCTCTCCGACGACCCGGCCACCGTGCGGCGCAAGGTGCTG
GGGATGTACACCGACCCGAACCGGGTCCGCGCCGACGTGCCGGGCACGGTCGAGGGGAAC
CCGGTCTTCGCGTACCTCGACGTGTTCCACACCGACCGGGCGACGGTCGAGGAGCTGAAG
GCGCGCTACCGGGCCGGCCGGGTCGGCGACGTCGAGGTCAAGGAGGAACTGGTGGGCGCG
CTCAACCGGTTCCTCGACCCGGTCCGCGAGCGGCGGGCCCGGTTCGAGGGGCAGCGCGGC
CTGGTCGACGAGCTGATCGTCGAGGGCACCGAGCGGACCCGGGCGCAGGTGCGCCGCACC
CTTGTCGAGGTGCGCCGGGCCATGGGCCTGACCAGCGCGTACACCCAGGTGCGGCGGCGG
GCCGAGCGCTACCGCAAGGCCGTCGGCACGCCGGCCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001412 Aminoacyl-tRNA synthetase, class I, conserved site (Conserved_site)
 [12-21]  PS00178
PS00178   AA_TRNA_LIGASE_I
IPR002305 Aminoacyl-tRNA synthetase, class Ic (Family)
 [4-285]  1.39999999999997e-72 PF00579
PF00579   tRNA-synt_1b
IPR002306 Tryptophanyl-tRNA synthetase (Family)
 [16-32]  3.39999972437717e-23 PR01039 [69-88]  3.39999972437717e-23 PR01039 [146-167]  3.39999972437717e-23 PR01039 [197-207]  3.39999972437717e-23 PR01039
PR01039   TRNASYNTHTRP
 [4-330]  2.20000000000002e-87 TIGR00233
TIGR00233   TrpS
IPR014729 Rossmann-like alpha/beta/alpha sandwich fold (Domain)
 [5-205]  3.19999999999996e-74 G3DSA:3.40.50.620
G3DSA:3.40.50.620   Rossmann-like_a/b/a_fold
SignalP No significant hit
TMHMM No significant hit