close all open/close all

CDS information : Dynm_00100


close this sectionLocation

Organism
StrainATCC 53710 (=NBRC 15963)
Entry nameDynemicin
Contig
Start / Stop / Direction16,939 / 18,657 / + [in whole cluster]
16,939 / 18,657 / + [in contig]
Location16939..18657 [in whole cluster]
16939..18657 [in contig]
TypeCDS
Length1,719 bp (572 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.1 general function
Productputative arginine--tRNA ligase
putative arginyl-tRNA synthetase
Product (GenBank)putative class Ic arginyl-tRNA synthetase
Geneorf11
argS
Gene (GenBank)
EC number6.1.1.19
Keyword
Note
Note (GenBank)
  • ORF11
Reference
ACC
PmId
[18328078] The biosynthetic genes encoding for the production of the dynemicin enediyne core in Micromonospora chersina ATCC53710. (FEMS Microbiol Lett. , 2008)
Related Reference
ACC
P11875
PmId
[2668891] Isolation and characterization of the gene coding for Escherichia coli arginyl-tRNA synthetase. (Nucleic Acids Res. , 1989)
Family/Domain
FD
IPR001278

close this sectionSequence

selected fasta
>putative arginine--tRNA ligase [putative class Ic arginyl-tRNA synthetase]
MDLEKLLTDRLAPAFATVAGGPVDPVVRRSQRADFQSDAALALARRLGRPPRAIATEVLE
RAELADLCSATEVSGPGFLNLTVADDALAGLVSALAADPRLGVPEAAAPETVVVDYSAPN
VAKEMHVGHLRSTVIGDAAARLLEWLGHRVLRANHLGDWGTPFGMLIEHLVDLGEAEAAQ
ELSMGDLDSFYKAARAKFDADEAFRERARQRVVALQGGDATTLRLWRLLVEQSERYFLTV
YDLLDVTLTERDFHGESSYNDLLGPVVEDLDRLGLLRSSDGAACVFPPGSVGRDGEPLPL
IVRKSDGGYGYPATDLAAIRHRTGTLGATRLLYVVGLPQRRHFEMVYAAAAQAGWLAPPA
RAEHVGFGSILGPDGRMLRSRASGSVKLVGLLEEAVARATALARERNPELGEAEAAEVGR
AVGIGAVKYADLSSDRHKDYVLDWERMLSLDGNSAPYLQYAHSRIRSIFRRAGVAARPEA
PVSLVDPAERALAFELVGFGAVVGAVAENLEFHHLTACLSRLAAAFSAFYERCPVLRADE
PVRESRLVLCDLTARVLRQGLHLLGIRTPERL
selected fasta
>putative arginine--tRNA ligase [putative class Ic arginyl-tRNA synthetase]
ATGGATCTGGAGAAACTGCTGACCGACCGGCTGGCGCCGGCGTTCGCCACGGTGGCCGGC
GGGCCGGTGGACCCGGTCGTGCGGCGCTCCCAGCGCGCGGACTTCCAGTCGGACGCGGCG
CTGGCGCTGGCGCGGCGGCTCGGCCGGCCGCCGCGCGCCATCGCCACCGAGGTGCTGGAG
CGCGCGGAACTGGCCGACCTGTGCAGCGCCACGGAGGTCTCCGGGCCGGGTTTCCTCAAC
CTGACCGTGGCCGACGACGCCCTGGCCGGGCTGGTCTCCGCGCTGGCCGCCGACCCGCGG
CTCGGGGTGCCGGAGGCCGCCGCGCCGGAGACCGTGGTGGTCGACTACTCCGCGCCGAAC
GTGGCGAAGGAGATGCACGTCGGGCACCTGCGCTCGACGGTGATCGGCGACGCGGCGGCC
CGGCTGCTGGAGTGGCTGGGGCACCGGGTGCTGCGCGCCAACCACCTGGGCGACTGGGGC
ACGCCCTTCGGCATGCTGATCGAGCACCTGGTCGACCTGGGCGAGGCCGAGGCGGCGCAG
GAGCTGTCGATGGGCGACCTGGACTCGTTCTACAAGGCGGCCCGGGCCAAGTTCGACGCC
GACGAGGCGTTCCGCGAGCGGGCCCGGCAGCGGGTGGTGGCGTTGCAGGGCGGCGACGCG
ACCACCCTGCGCCTCTGGCGGCTGCTCGTGGAGCAGTCCGAGCGCTACTTCCTGACCGTC
TACGACCTGCTCGACGTGACCCTCACCGAGCGGGACTTCCACGGCGAGAGCAGCTACAAC
GACCTGCTCGGCCCGGTCGTCGAGGACCTGGACCGGCTCGGGCTGCTGCGGTCCAGCGAC
GGCGCGGCGTGCGTGTTCCCGCCCGGCTCGGTGGGCCGGGACGGGGAGCCGCTGCCGCTG
ATCGTGCGCAAGTCCGACGGCGGGTACGGCTACCCGGCGACCGACCTCGCCGCGATCCGG
CACCGGACCGGCACGCTGGGCGCGACCCGGCTGCTCTACGTGGTCGGGCTGCCGCAGCGG
CGGCACTTCGAGATGGTCTACGCCGCCGCCGCGCAGGCCGGTTGGTTGGCCCCGCCGGCC
CGGGCCGAGCACGTCGGGTTCGGCTCGATCCTCGGCCCCGACGGGCGGATGCTGCGCAGC
CGGGCCAGCGGGTCGGTCAAGTTGGTCGGGCTGCTGGAGGAGGCGGTGGCCCGGGCCACC
GCGCTGGCCCGGGAGCGGAACCCGGAGCTGGGCGAGGCCGAGGCGGCCGAGGTGGGCCGC
GCGGTCGGCATCGGCGCGGTCAAGTACGCCGACCTCTCCAGCGACCGGCACAAGGACTAC
GTGCTCGACTGGGAGCGGATGCTGTCGCTGGACGGCAACAGCGCGCCCTACCTCCAGTAC
GCCCACTCCCGGATCCGGTCGATCTTCCGGCGGGCCGGGGTTGCGGCCCGGCCCGAGGCA
CCGGTCTCGCTGGTGGATCCGGCCGAGCGGGCGCTCGCCTTCGAGCTGGTCGGCTTCGGG
GCGGTGGTCGGCGCGGTGGCGGAGAACCTGGAGTTCCACCACCTGACCGCTTGCCTGTCC
CGGCTCGCCGCCGCGTTCAGCGCGTTCTACGAGCGGTGCCCGGTGCTGCGGGCCGACGAG
CCGGTCCGGGAGAGCCGGCTGGTGCTCTGCGACCTGACCGCGCGGGTGCTCCGGCAGGGC
CTCCACCTGCTCGGCATCCGCACCCCGGAGCGGCTGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001278 Arginyl-tRNA synthetase, class Ia (Family)
 [29-572]  3.3000000000001e-130 TIGR00456
TIGR00456   ArgS
IPR001412 Aminoacyl-tRNA synthetase, class I, conserved site (Conserved_site)
 [119-130]  PS00178
PS00178   AA_TRNA_LIGASE_I
IPR005148 Arginyl tRNA synthetase N-terminal domain (Domain)
 [22-95]  1.3e-12 G3DSA:3.30.1360.70
G3DSA:3.30.1360.70   Arg-tRNA-synth_Ic_N
 [3-82]  2.5e-12 PF03485
PF03485   Arg_tRNA_synt_N
 [1-102]  2.800005042611e-17 SSF55190
SSF55190   Arg-tRNA-synth_Ic_N
 [1-83]  1.99999636034521e-20 SM01016
SM01016   Arg_tRNA_synt_N
IPR008909 DALR anticodon binding (Domain)
 [458-572]  5.69999999999998e-29 PF05746
PF05746   DALR_1
 [458-572]  2.1000026783403e-36 SM00836
SM00836   DALR_1
IPR009080 Aminoacyl-tRNA synthetase, class 1a, anticodon-binding (Domain)
 [452-572]  4.79998722798115e-35 SSF47323
SSF47323   tRNAsyn_1a_bind
IPR014729 Rossmann-like alpha/beta/alpha sandwich fold (Domain)
 [107-450]  2.79999999999994e-89 G3DSA:3.40.50.620
G3DSA:3.40.50.620   Rossmann-like_a/b/a_fold
IPR015945 Arginyl-tRNA synthetase, class Ia, core (Domain)
 [111-126]  3.49999466863949e-24 PR01038 [126-142]  3.49999466863949e-24 PR01038 [150-163]  3.49999466863949e-24 PR01038 [301-322]  3.49999466863949e-24 PR01038
PR01038   TRNASYNTHARG
 [94-444]  5.00000000000001e-87 PF00750
PF00750   tRNA-synt_1d
SignalP No significant hit
TMHMM No significant hit