close all open/close all

CDS information : Dynm_00120


close this sectionLocation

Organism
StrainATCC 53710 (=NBRC 15963)
Entry nameDynemicin
Contig
Start / Stop / Direction20,201 / 19,092 / - [in whole cluster]
20,201 / 19,092 / - [in contig]
Locationcomplement(19092..20201) [in whole cluster]
complement(19092..20201) [in contig]
TypeCDS
Length1,110 bp (369 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.4 hypothetical protein
Producthypothetical protein
Product (GenBank)putative xanthine/CO dehydrogenases maturation factor
GenedynE12
Gene (GenBank)
EC number
Keyword
Note
  • The N-terminal position was modified from original INSDC entry.
Note (GenBank)
  • ORF13; XdhC/CoxF family
Reference
ACC
PmId
[18328078] The biosynthetic genes encoding for the production of the dynemicin enediyne core in Micromonospora chersina ATCC53710. (FEMS Microbiol Lett. , 2008)

close this sectionSequence

selected fasta
>hypothetical protein [putative xanthine/CO dehydrogenases maturation factor]
MRDVLPDLLRWWRAGVPVGMATVARTWQSAPRRPGATLLVGPDGSAVGSVSGGCVEAAVY
ELCREVVADATPRSVRFGVSDDDALAAGLTCGGTVELYVERVDRESFPQLDRVAAEVAAG
RPVAVATCVDGPPGRRGRRIVLDAEGRHGSLGEPAVDAAVAAEARALLRAGRSGVVRPRP
VGEELSVLVVAAPAPARMLVFGAVDFAAAVAQAGRFLGYRVTVCDARPVFATPRRFPGAH
EVVVDWPHRYLAAEAAAGRVDARTVVCVLTHDARFDVPVLRHALDLPLAYVGAMGSRRTA
EDRRRRLREAGVTEAALARLRAPIGLDLGGQTPEETAVSIAAEIVAVTRGGGGVPLSRLA
GRIHADAPR
selected fasta
>hypothetical protein [putative xanthine/CO dehydrogenases maturation factor]
ATGCGTGACGTCCTGCCCGACCTGCTGCGCTGGTGGCGTGCCGGCGTGCCGGTCGGCATG
GCCACGGTGGCCCGCACCTGGCAGAGCGCCCCGCGCCGGCCCGGTGCCACGCTGCTGGTC
GGGCCGGACGGCAGCGCGGTCGGCAGTGTCTCCGGCGGCTGCGTGGAGGCGGCGGTCTAC
GAGCTGTGCCGGGAGGTCGTCGCCGACGCCACGCCGCGGTCGGTCCGCTTCGGGGTGAGC
GACGACGACGCACTGGCCGCCGGCCTCACCTGCGGCGGGACCGTCGAGCTGTACGTGGAG
CGGGTCGACCGGGAGAGCTTCCCGCAGCTCGACCGGGTCGCCGCCGAGGTCGCCGCTGGC
CGGCCCGTGGCGGTCGCGACCTGTGTGGACGGCCCGCCGGGCCGGCGGGGCCGGCGGATC
GTGCTGGACGCCGAGGGGCGGCACGGCAGCCTGGGCGAGCCGGCCGTGGACGCGGCGGTC
GCCGCCGAGGCGCGGGCGCTGCTGCGCGCGGGCCGCTCCGGCGTGGTCCGCCCCCGGCCG
GTCGGGGAGGAGCTGTCCGTGCTGGTGGTGGCCGCTCCGGCGCCGGCCCGGATGCTGGTC
TTCGGGGCCGTCGACTTCGCAGCCGCGGTGGCCCAGGCGGGCCGGTTCCTCGGCTACCGG
GTGACGGTCTGCGACGCCCGGCCGGTCTTCGCCACCCCGCGGCGGTTCCCCGGGGCGCAC
GAGGTGGTGGTCGACTGGCCGCACCGCTACCTGGCCGCCGAGGCCGCGGCCGGCCGGGTC
GACGCCCGGACCGTGGTCTGCGTACTCACCCACGACGCCCGCTTCGACGTGCCGGTCCTG
CGCCACGCTCTCGACCTGCCGCTGGCGTACGTCGGGGCGATGGGCTCCCGGCGCACCGCC
GAGGACCGGCGACGCCGCCTGCGCGAGGCCGGCGTGACCGAGGCGGCACTGGCCCGGCTG
CGCGCCCCGATCGGCCTGGACCTGGGCGGGCAGACGCCGGAGGAGACCGCCGTCAGCATC
GCCGCCGAGATCGTGGCGGTGACGCGCGGCGGTGGCGGCGTCCCGCTGTCCCGCCTGGCG
GGCCGCATCCACGCGGACGCGCCCCGCTAG

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR003777 XdhC- CoxI (Family)
 [10-78]  6.2e-22 PF02625 [115-177]  1.3e-09 PF02625
PF02625   XdhC_CoxI
SignalP No significant hit
TMHMM No significant hit