close all open/close all

CDS information : Dynm_00130


close this sectionLocation

Organism
StrainATCC 53710 (=NBRC 15963)
Entry nameDynemicin
Contig
Start / Stop / Direction20,781 / 20,194 / - [in whole cluster]
20,781 / 20,194 / - [in contig]
Locationcomplement(20194..20781) [in whole cluster]
complement(20194..20781) [in contig]
TypeCDS
Length588 bp (195 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.4 hypothetical protein
Producthypothetical protein
Product (GenBank)hypothetical protein
Geneorf12
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)
  • ORF14; uncharacterized MobA-related protein
Reference
ACC
PmId
[18328078] The biosynthetic genes encoding for the production of the dynemicin enediyne core in Micromonospora chersina ATCC53710. (FEMS Microbiol Lett. , 2008)

close this sectionSequence

selected fasta
>hypothetical protein [hypothetical protein]
MSPPPAGVLLAAGAGRRYGGPKALARHADGRLLVERAAGMLSGGGCAPTVVVLGAAAAEV
RARADLPGALLVDNPEWAGGMGSSLRAGLAALARTDAPAAVVLLVDLPGVTAAAVRRVAR
HATADSLVTAGYPAGRRGHPVLLGRRHWPGVAALAVGDTGARAYLRAHLDEVRVVDCADV
ADDADLDVPAGRTDA
selected fasta
>hypothetical protein [hypothetical protein]
ATGTCGCCGCCCCCGGCCGGCGTGCTGCTCGCGGCCGGTGCCGGTCGCCGGTACGGCGGC
CCGAAGGCGCTGGCGCGGCACGCCGACGGCCGGCTGCTGGTGGAGCGTGCGGCGGGGATG
CTCAGCGGCGGCGGCTGCGCGCCCACGGTGGTGGTGCTCGGCGCGGCCGCGGCCGAGGTG
CGGGCCCGCGCCGACCTGCCCGGCGCGCTGCTCGTGGACAACCCGGAGTGGGCCGGCGGG
ATGGGCTCCTCGCTGCGCGCCGGGCTGGCCGCGCTGGCCCGCACGGACGCGCCGGCGGCG
GTGGTGCTCCTCGTCGACCTGCCCGGCGTCACCGCGGCGGCGGTCCGCCGGGTGGCCCGG
CACGCCACTGCCGACAGCCTGGTGACGGCCGGCTACCCGGCCGGCCGCCGGGGCCATCCC
GTGCTGCTGGGCCGCCGGCACTGGCCCGGTGTGGCCGCGCTGGCGGTGGGCGACACGGGT
GCCCGGGCCTACCTGCGGGCGCACCTCGACGAGGTCCGGGTGGTCGACTGTGCCGACGTG
GCCGACGACGCCGACCTGGACGTGCCGGCGGGGCGGACGGATGCGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR025877 MobA-like NTP transferase domain (Domain)
 [7-189]  1.09999999999999e-33 PF12804
PF12804   NTP_transf_3
SignalP No significant hit
TMHMM No significant hit