close all open/close all

CDS information : Dynm_00140


close this sectionLocation

Organism
StrainATCC 53710 (=NBRC 15963)
Entry nameDynemicin
Contig
Start / Stop / Direction22,653 / 20,782 / - [in whole cluster]
22,653 / 20,782 / - [in contig]
Locationcomplement(20782..22653) [in whole cluster]
complement(20782..22653) [in contig]
TypeCDS
Length1,872 bp (623 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category4.1 transcriptional regulator
Productputative transcriptional regulator
Product (GenBank)CalR2-like protein
Geneorf13
Gene (GenBank)
EC number
Keyword
  • SARP family
Note
Note (GenBank)
  • ORF15; transcriptional regulator
Reference
ACC
PmId
[18328078] The biosynthetic genes encoding for the production of the dynemicin enediyne core in Micromonospora chersina ATCC53710. (FEMS Microbiol Lett. , 2008)
Related Reference
ACC
Q2MGB3
NITE
Fred_00260
PmId
[18556785] Identification and utility of FdmR1 as a Streptomyces antibiotic regulatory protein activator for fredericamycin production in Streptomyces griseus ATCC 49344 and heterologous hosts. (J Bacteriol. , 2008)

close this sectionSequence

selected fasta
>putative transcriptional regulator [CalR2-like protein]
MKRQLSVTVLGTVQVHDGTAPVDLGPSKQRALLALLALQVGENIPVGALALALWGDNPPP
SGSHLLHTYVARLRRALEPGSPRHARTNVIASSPRAYRLQLYADQVDLTRFRRLAEAARE
LIRRDRRSAAFELLDAAVAMWTDPDLTDLRALLPGEEAVAALRREWVTACLDLVTLGLEL
DRPAAVLATAEHLAAAEPLHEAVQARHLTVLARTGRRAAALDRFAGIRARLAAELGIEPG
PELTAAHRELRDGPAAARPAVPPPGCVASRPRPPWRGTRPGATELIGRETDLARVTGLLT
DHRVVTVAGPAGCGKSALALAAARRVHPGYADGVLSVDLAAARTPDDVTREIRRLLRLPE
RGGLPRLLADRHLLLVLDNVDHLTDSCAGLVDDVVQVGRRVSALVTSREPLGLAYESVWR
LPPLPALTTGPDGVRGMPAVQLFARRAAQARPGFEVGAKEIGTVAVICGLLDRLPLAVEL
AADRMADESLDELLRRLDDPLTALRRPDRRGRPAHQTSLSAALQRSLDCLTPAERWCFVR
LGALPRLFGLDEVDRVCGAAPWWRLRTSVVLDGLVAKSLVTVRHHAGRPTYAMLRTVHQF
AARLLAGELGQYGSAPALSARVG
selected fasta
>putative transcriptional regulator [CalR2-like protein]
GTGAAACGTCAGCTGTCGGTCACCGTGCTCGGCACGGTCCAGGTCCACGACGGCACCGCC
CCGGTGGATCTCGGCCCGTCGAAGCAGCGCGCCCTGCTCGCCCTGCTGGCCCTCCAGGTG
GGCGAGAACATCCCCGTCGGCGCGCTCGCCCTGGCGCTGTGGGGCGACAACCCCCCGCCC
AGCGGCAGCCACCTCCTGCACACCTACGTGGCGCGGCTGCGGCGGGCGCTGGAACCCGGC
TCGCCCCGGCACGCCCGCACCAACGTCATCGCGTCGTCGCCCCGGGCGTACCGGTTGCAG
CTCTACGCCGACCAGGTCGACCTGACCCGGTTCCGCCGGCTCGCCGAGGCCGCGCGGGAG
CTGATCCGCCGCGACCGGCGGTCCGCCGCCTTCGAGCTGCTGGACGCGGCCGTCGCCATG
TGGACCGACCCCGACCTCACCGACCTGCGGGCCCTGCTGCCCGGGGAGGAGGCGGTCGCG
GCGCTGCGCCGCGAATGGGTCACCGCCTGCCTCGACCTGGTCACCCTCGGCCTCGAACTC
GACCGGCCCGCCGCGGTGCTGGCCACCGCGGAACACCTCGCCGCCGCCGAGCCGCTGCAC
GAGGCGGTGCAGGCGCGGCACCTCACCGTGCTGGCGCGCACGGGCCGGCGGGCGGCCGCC
CTGGACCGGTTCGCCGGGATCCGCGCCCGGCTCGCCGCCGAGCTGGGCATCGAACCGGGC
CCCGAGCTGACCGCGGCCCACCGCGAGCTGCGGGACGGCCCGGCGGCCGCCCGGCCGGCG
GTCCCGCCGCCCGGCTGCGTGGCGAGCCGGCCCCGGCCGCCCTGGCGCGGCACCCGGCCC
GGCGCGACCGAGCTGATCGGCCGGGAGACCGACCTGGCCCGGGTGACCGGGCTGCTCACC
GACCACCGGGTGGTCACCGTGGCCGGGCCGGCCGGCTGCGGCAAGTCGGCGCTGGCCCTG
GCCGCCGCCCGCCGGGTCCACCCCGGGTACGCCGACGGCGTCCTGTCCGTCGACCTCGCC
GCGGCCCGCACGCCGGACGACGTCACCCGGGAGATCCGCCGGCTGCTCCGCCTGCCCGAG
CGGGGCGGCCTGCCCCGGCTGCTGGCCGACCGCCACCTGCTGCTCGTGCTGGACAACGTG
GACCACCTCACCGACAGCTGCGCCGGCCTGGTCGACGACGTCGTGCAGGTGGGCCGCCGG
GTGTCGGCGCTGGTCACCTCGCGGGAGCCGCTGGGCCTGGCGTACGAGTCGGTGTGGCGG
CTGCCGCCGCTGCCCGCGCTCACCACCGGCCCGGACGGCGTCCGGGGGATGCCGGCCGTC
CAGCTCTTCGCCCGCCGGGCGGCCCAGGCGCGTCCCGGCTTCGAGGTGGGCGCGAAGGAG
ATCGGCACGGTGGCGGTGATCTGCGGGCTGCTCGACCGGCTGCCCCTCGCCGTCGAACTG
GCCGCCGACCGGATGGCCGACGAGAGCCTCGACGAGCTGCTGCGCCGGCTCGACGACCCG
CTGACCGCGCTGCGCCGGCCCGACCGGCGGGGGCGGCCGGCCCACCAGACCTCGCTCTCC
GCCGCCCTCCAGCGCAGTCTCGACTGCCTCACCCCGGCCGAGCGCTGGTGCTTCGTACGG
CTCGGCGCGCTGCCCCGGCTCTTCGGCCTCGACGAGGTGGACCGGGTCTGCGGCGCCGCG
CCCTGGTGGCGGCTGCGGACCAGCGTGGTCCTCGACGGCCTGGTGGCGAAGTCCCTGGTG
ACGGTCCGCCACCACGCCGGCCGCCCCACGTACGCGATGCTGCGCACCGTGCACCAGTTC
GCCGCCCGGCTGCTCGCCGGCGAGCTGGGCCAGTACGGCAGCGCACCGGCCCTGTCCGCG
CGGGTGGGCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000767 Disease resistance protein (Family)
 [304-319]  1.19999985703101e-05 PR00364 [367-381]  1.19999985703101e-05 PR00364 [471-485]  1.19999985703101e-05 PR00364
PR00364   DISEASERSIST
IPR001867 Signal transduction response regulator, C-terminal (Domain)
 [27-84]  3.1e-08 PF00486
PF00486   Trans_reg_C
 [19-99]  1.49999977583352e-11 SM00862
SM00862   Trans_reg_C
IPR003593 AAA+ ATPase domain (Domain)
 [301-492]  9.00000407957274e-09 SM00382
SM00382   AAA
IPR005158 Bacterial transcriptional activator domain (Domain)
 [106-251]  3.10001307370206e-33 SM01043
SM01043   BTAD
 [106-251]  3.60000000000001e-29 PF03704
PF03704   BTAD
IPR011991 Winged helix-turn-helix transcription repressor DNA-binding (Domain)
 [14-81]  4.5e-07 G3DSA:1.10.10.10
G3DSA:1.10.10.10   Wing_hlx_DNA_bd
IPR016032 Signal transduction response regulator, C-terminal effector (Domain)
 [4-100]  5.50000546509999e-11 SSF46894
SSF46894   Bipartite_resp_reg_C-effector
SignalP No significant hit
TMHMM No significant hit