close all open/close all

CDS information : Dynm_00170


close this sectionLocation

Organism
StrainATCC 53710 (=NBRC 15963)
Entry nameDynemicin
Contig
Start / Stop / Direction25,826 / 26,815 / + [in whole cluster]
25,826 / 26,815 / + [in contig]
Location25826..26815 [in whole cluster]
25826..26815 [in contig]
TypeCDS
Length990 bp (329 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.3 uncharacterized protein (biosynthesis involved)
Producthypothetical protein
Product (GenBank)DynT3
GenedynT3
unbU
Gene (GenBank)
EC number
Keyword
  • enediyne core
Note
Note (GenBank)
  • hypothetical protein; CalT3-like protein
Reference
ACC
PmId
[18328078] The biosynthetic genes encoding for the production of the dynemicin enediyne core in Micromonospora chersina ATCC53710. (FEMS Microbiol Lett. , 2008)
[12536216] A genomics-guided approach for discovering and expressing cryptic metabolic pathways. (Nat Biotechnol. , 2003)

close this sectionSequence

selected fasta
>hypothetical protein [DynT3]
MSDKATPRTANRPDPRITALRRFALSITVFNIVGHLLLGFEQAYVTPVVAVLIAYAVDLL
LETVEARATGRPERYRGGPVALLNFLLPAHIAGLACAMLLYGNQSLAPTMFAAAVAVSSK
YVIRLPVRGSLRHVLNPSNFGISVTLILFSWVSIAPPYHFSEDVDGPVDVVIPLVILAAG
TMLNGKLTRRLPLILGWAGGFVLQAVLRAVFFDAHLAAALLPMTGIAFILFTNYMITDPG
TTPAAPRRQVVFGLATAAVYGLLVLAHITFGLFFALVIVCGLRALVILGANLRDRANGTP
ALSAGRPAGTPPADAAPVDVGQVPVPAAR
selected fasta
>hypothetical protein [DynT3]
GTGTCCGACAAGGCCACTCCCCGTACGGCGAACCGACCGGACCCACGGATCACGGCGCTG
CGCCGGTTCGCGCTGTCCATCACCGTCTTCAACATCGTCGGGCACCTGCTGCTCGGGTTC
GAGCAGGCGTACGTCACGCCGGTCGTGGCGGTGCTCATCGCGTACGCGGTGGACCTGCTG
CTGGAGACCGTCGAGGCGCGCGCCACCGGGCGCCCCGAGCGCTACCGGGGCGGACCGGTG
GCCCTGCTGAACTTCCTGCTGCCCGCCCACATCGCCGGCCTGGCCTGCGCCATGCTGCTC
TACGGCAACCAGAGCCTGGCGCCCACCATGTTCGCCGCCGCGGTGGCGGTGAGCAGCAAG
TACGTCATCCGGCTGCCGGTCCGCGGCAGCCTGCGGCACGTGCTCAACCCGAGCAACTTC
GGCATCAGCGTCACGCTGATCCTGTTCAGCTGGGTCAGCATCGCACCGCCGTACCACTTC
AGCGAGGACGTGGACGGGCCGGTCGACGTGGTGATCCCGCTGGTCATCCTGGCCGCCGGC
ACCATGCTCAACGGCAAGCTGACCCGGCGGCTGCCGCTGATCCTGGGCTGGGCCGGCGGC
TTCGTCCTCCAGGCGGTGCTGCGCGCGGTGTTCTTCGACGCGCACCTGGCCGCCGCGCTG
CTGCCGATGACCGGTATCGCGTTCATCCTCTTCACCAATTACATGATCACCGACCCGGGC
ACGACGCCGGCCGCCCCGCGCCGGCAGGTGGTGTTCGGCCTGGCCACGGCGGCCGTCTAC
GGGCTGCTGGTCCTCGCCCACATCACGTTCGGCCTGTTCTTCGCGCTGGTGATCGTCTGC
GGCCTGCGCGCCCTGGTGATCCTCGGCGCCAACCTGCGCGACCGGGCGAACGGCACACCC
GCGCTGAGCGCCGGCCGGCCCGCCGGGACCCCGCCGGCCGACGCGGCCCCCGTCGACGTG
GGCCAGGTGCCGGTGCCCGCCGCCCGCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro No significant hit
SignalP No significant hit
TMHMM
 [20-39]  Transmembrane (i-o) [43-60]  Transmembrane (o-i) [80-102]  Transmembrane (i-o) [106-123]  Transmembrane (o-i) [136-155]  Transmembrane (i-o) [170-187]  Transmembrane (o-i) [194-211]  Transmembrane (i-o) [215-237]  Transmembrane (o-i) [250-269]  Transmembrane (i-o) [273-292]  Transmembrane (o-i)
Transmembrane 10