close all open/close all

CDS information : Dynm_00180


close this sectionLocation

Organism
StrainATCC 53710 (=NBRC 15963)
Entry nameDynemicin
Contig
Start / Stop / Direction26,849 / 32,551 / + [in whole cluster]
26,849 / 32,551 / + [in contig]
Location26849..32551 [in whole cluster]
26849..32551 [in contig]
TypeCDS
Length5,703 bp (1,900 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category1.1 PKS
Productpolyketide synthase
Product (GenBank)DynE8
GenedynE8
Gene (GenBank)
EC number
Keyword
  • iterative
  • enediyne core
Note
Note (GenBank)
  • iterative polyketide synthase for enediyne core
Reference
ACC
PmId
[18328078] The biosynthetic genes encoding for the production of the dynemicin enediyne core in Micromonospora chersina ATCC53710. (FEMS Microbiol Lett. , 2008)
[22589546] Crystal structure of the acyltransferase domain of the iterative polyketide synthase in enediyne biosynthesis. (J Biol Chem. , 2012)
[12536216] A genomics-guided approach for discovering and expressing cryptic metabolic pathways. (Nat Biotechnol. , 2003)
[25019332] Enediyne polyketide synthases stereoselectively reduce the beta-ketoacyl intermediates to beta-D-hydroxyacyl intermediates in enediyne core biosynthesis. (Org Lett. , 2014)

close this sectionPKS/NRPS Module

1 acetyl-CoA
malonyl-CoA
KS4..408
AT617..815
ACP917..1011
KR1194..1368
DH1438..1587
PPT1685..1891

close this sectionSequence

selected fasta
>polyketide synthase [DynE8]
MVDDDVVIVGLACRYPAADNPTQLWENVLNRRQAFRPLPAGRLPLAEYGGDGPDRTTVRR
AAVLDGWRFDRARFRIPGSTFRAVDLSHWLALETAADALVDAGLPDGTGTDRSRVGVVIG
NSLTGEFSRAAGLRIRWPYVRRAVAAGLVDGGLATDEVAALLDRVEERFKAPFPVPGDET
LAGALANTIAGRICNQFDFHGTGYTVDGACASSLLAVITAAEAVAAGQLDVALAGGVDLS
LDPLELVGFSRVGALAGDEMRVYDAHPTGFLPGEGCGVVVLARAGYARERGLRPYGRLLG
WASSSDGSGGLTRPEESGQRLALRRAYDRAGIEPGAVRLVEGHGTGTAVGDEAELRALLG
VRGPAASPAVLGSIKANIGHTKAAAGVAGLIKAVLAVHREVLPPTTGCHRPHPLLAEGGA
LRVTDEARPWPDGERYASVSAMGFGGINTHVVLGGTAPSASRPLSAHVRRLSRPHPDHEL
VVCGAPDAAALTGLLTRVRAAATALSRPELTDLAAGLAAAHRGDVPARFAAAVRDADGLV
AALDRALGHLAEGGRRLLDAGRGLFLVVGGPLRVGLLFPGQAAPVHADRGALGHLLGDAD
AGTGSDPDSGVKPAEPVDTAVAQPAIIADSLAGIRWLDRLGARPVGALGHSLGELAALSW
AGALDADDTLALARARGEAMSAATEAPSGMLSLRADLAAARELAAGTGAVVAVDNGERHV
VVAGTRPELDRVAEAARHAGIEATPLAVSHAFHSPLMAPAAEALRRAAGRLPWRRPERPV
ASTVTGAWWADEDPVEVLVRQLTGPVRFREALGLLDADLLVEVGPGRMLSALAEAAGRTA
VSLDAGAASAAGMAAGTAALFAAGAVDDATPFFAGRFTRPFDRDREREFLVNPCEREVPA
VALPAPRAATPDPRPRASAGPVAARPADGRGTAELVAARVADLAELPAAEVGPGTRLLAD
LHLNSIRVGQLAAEIAGELGRALPATPLSLADATVGEFAAAIEGLPTADAPAAELPAAGV
GPWVRVFRHHLVPRPAGAAAPAGEPPAWEVVGPLAGHPHAEAVRTAFRVDAGAPAGRLLA
LPPGLADIPTADVVAALRAAAGDRRPLVVLHHGGVGAAVGRSLAVETGAPVLVVETPPGP
AGVRLAAVEASRPWSGYQEVVYGADGVRTVPVTRLLDGQPRTDRRIPLGPGEVCLVTGGA
KGIGAACAAALGEATGARLVLFGRSPADDPEVVEAVRRTGAVYRSVDLADPVAVAAAVTA
VRAEHGPVRGLLHAAGRNEPAPVTDLTAEELHRTLAPKAYGFEHVVAALDPDELRFAVAF
GSVIGRAGLPGEAAYATANEYLSRRCAELAATVPQVRWLSIEWSVWSGTGMGVRLGVLDG
LLRRGVSPIPPDEGTRLLLELLATPALPPVVLVAGRLPVSDTLEWDECAEEHGRFLESRL
VGTPCVELVSEARLSLGADPYLDDHRIDGAAVLPAVLGLEAMAQAAAALGAKQVPTVIRD
VALTRPVTVGDREPRPVRVAALTGADGTVRAAVRSAETGFAVDHLTGTYGGAVTSGEPVP
PPSTGLLVPGGPLYGPAFFHGPRFRRVAGYHGLSAYRCVAEVHAEAGTWFGGFHDQRLQL
GDPGVRDAFLHLLQACVPDRRVLPVGVDRIDIHARPEGTLTVHARQVAEAGDEFRFDVTV
IDADGSPVERWTGLRLRAVGPVENAVWPAELVGPLVTRRLRRWRPELRVDLAAAPAGRGD
RERSRALAGWLLGGEVRADATGRLRPGVPATPLGWRGISVSHLDGHLLTAAADRPVGVDW
EVVTPTPPLPEAAARVAEALARLTGEDAATAGTRVWTALEALVKAGAAVDVPLVLRDETG
PDGWVALHAGRHAVYGTVVPATPGPIAVSLAVAVDADGEG
selected fasta
>polyketide synthase [DynE8]
ATGGTCGACGACGACGTGGTGATCGTGGGCCTGGCCTGCCGCTACCCGGCGGCGGACAAC
CCGACCCAGCTGTGGGAGAACGTCCTCAACCGGCGGCAGGCGTTCCGGCCGCTGCCGGCG
GGCCGGCTGCCGCTGGCCGAGTACGGCGGCGACGGCCCCGACCGGACCACGGTCCGCCGG
GCCGCGGTACTGGACGGCTGGCGCTTCGACCGGGCCCGCTTCCGGATCCCGGGCAGCACC
TTCCGGGCCGTGGACCTGTCCCACTGGCTGGCGCTGGAGACCGCCGCGGACGCCCTTGTC
GACGCCGGCCTGCCGGACGGGACCGGCACCGACCGGTCCCGGGTCGGCGTGGTCATCGGC
AATTCGCTGACCGGCGAGTTCTCCCGGGCCGCCGGCCTGCGGATCCGCTGGCCCTACGTG
CGCCGGGCGGTCGCCGCCGGCCTGGTCGACGGAGGGCTGGCGACCGACGAGGTCGCGGCG
CTGCTGGACCGGGTGGAGGAGCGGTTCAAAGCGCCGTTCCCGGTGCCCGGCGACGAGACC
CTGGCCGGCGCGCTGGCAAACACGATCGCGGGCCGCATCTGCAACCAGTTCGACTTCCAC
GGCACCGGCTACACAGTGGACGGCGCCTGCGCCTCGTCGCTGCTCGCGGTGATCACCGCG
GCCGAGGCGGTGGCCGCCGGCCAGCTCGACGTGGCGCTGGCCGGCGGGGTGGACCTCAGC
CTCGACCCGCTGGAGCTGGTCGGCTTCTCCCGGGTCGGCGCGCTGGCCGGCGACGAGATG
CGGGTGTACGACGCCCACCCCACCGGCTTCCTGCCCGGCGAGGGCTGCGGCGTGGTGGTG
CTGGCCCGGGCCGGGTACGCGCGGGAGCGGGGGCTGCGCCCGTACGGGCGGCTGCTCGGC
TGGGCGTCCTCGTCGGACGGCAGCGGCGGGCTGACCCGGCCGGAGGAGAGCGGGCAGCGG
CTGGCGCTGCGCCGGGCGTACGACCGGGCCGGCATCGAGCCCGGCGCGGTCCGGCTCGTG
GAGGGGCACGGCACCGGCACCGCCGTCGGCGACGAGGCGGAACTGCGGGCGCTGCTCGGC
GTACGCGGGCCGGCCGCGTCACCGGCGGTGCTGGGCAGCATCAAGGCGAACATCGGGCAC
ACCAAGGCGGCGGCCGGGGTGGCCGGGCTGATCAAGGCGGTGCTGGCCGTGCACCGGGAG
GTGCTGCCGCCGACCACCGGCTGCCACCGGCCGCACCCGCTGCTCGCCGAGGGTGGCGCC
CTGCGGGTCACCGACGAGGCCCGGCCCTGGCCGGACGGCGAGCGGTACGCCTCGGTCAGC
GCGATGGGCTTCGGCGGGATCAACACGCACGTGGTGCTCGGCGGGACGGCTCCGTCGGCG
TCCCGGCCGCTCAGCGCGCACGTACGACGGTTGAGCCGGCCGCACCCCGACCACGAGCTG
GTGGTCTGCGGGGCCCCGGACGCGGCGGCGCTGACCGGGCTGCTCACCCGGGTCCGGGCG
GCGGCCACCGCGCTGTCCCGCCCCGAGCTGACCGACCTGGCCGCCGGGCTCGCCGCCGCC
CACCGCGGGGACGTCCCGGCCCGGTTCGCCGCGGCCGTCCGCGACGCCGACGGGCTGGTC
GCCGCCCTCGACCGGGCGCTCGGGCACCTGGCCGAGGGCGGCCGTCGCCTGCTGGACGCG
GGTCGCGGGCTGTTCCTCGTGGTCGGCGGGCCGCTGCGGGTGGGGCTGCTCTTCCCCGGC
CAGGCCGCACCGGTGCACGCCGACCGGGGCGCGCTGGGCCACCTGCTCGGCGACGCGGAC
GCGGGAACCGGCTCCGACCCCGATTCCGGGGTGAAGCCGGCGGAACCGGTCGACACGGCG
GTGGCCCAGCCGGCCATCATCGCCGACAGCCTGGCCGGGATCCGCTGGCTGGACCGGCTC
GGCGCCCGGCCGGTCGGCGCGCTCGGCCACAGCCTCGGCGAGCTGGCCGCGCTCAGCTGG
GCCGGTGCGCTGGACGCCGACGACACCCTGGCCCTGGCCCGCGCGCGCGGCGAGGCCATG
TCCGCCGCGACCGAGGCGCCCTCCGGGATGCTGTCGCTCCGGGCCGACCTGGCCGCCGCG
CGGGAACTGGCCGCCGGGACCGGCGCGGTGGTGGCCGTGGACAACGGCGAGAGGCACGTG
GTGGTGGCCGGCACCCGGCCCGAGCTGGACCGGGTCGCCGAGGCCGCGCGGCACGCCGGG
ATCGAGGCGACGCCGCTGGCCGTCTCGCACGCCTTCCACTCCCCGCTGATGGCCCCGGCC
GCCGAGGCGCTGCGCCGGGCCGCCGGGCGGCTCCCGTGGCGGCGGCCCGAGCGGCCGGTG
GCGTCCACGGTCACCGGGGCGTGGTGGGCCGACGAGGACCCGGTCGAGGTGCTGGTCCGG
CAGCTCACCGGGCCGGTCCGGTTCCGCGAGGCGCTCGGCCTGCTCGACGCCGACCTGCTC
GTTGAGGTCGGCCCCGGGCGGATGCTCAGCGCGCTGGCCGAGGCGGCCGGGCGTACCGCG
GTCAGCCTGGACGCCGGCGCGGCGAGCGCGGCGGGCATGGCCGCCGGTACCGCGGCGCTC
TTCGCCGCCGGCGCTGTCGACGACGCGACGCCCTTCTTCGCCGGGCGCTTCACCCGCCCG
TTCGACAGGGACCGGGAGCGGGAGTTCCTGGTCAACCCGTGCGAGCGGGAGGTGCCCGCG
GTGGCCCTGCCGGCGCCCCGCGCCGCGACGCCGGACCCGCGCCCCCGGGCGAGCGCCGGG
CCGGTCGCGGCCCGCCCGGCCGACGGCCGGGGCACCGCCGAGCTGGTCGCCGCCCGCGTG
GCCGACCTGGCCGAGCTGCCGGCCGCCGAGGTGGGCCCGGGCACCCGCCTCCTCGCCGAC
CTGCACCTGAACTCGATCCGGGTCGGCCAGCTCGCCGCCGAGATCGCCGGGGAACTGGGC
CGGGCGCTGCCCGCCACGCCGCTGTCCCTGGCCGACGCCACGGTGGGCGAGTTCGCCGCC
GCGATCGAGGGGCTGCCGACCGCCGACGCACCCGCCGCCGAGCTGCCCGCCGCCGGCGTC
GGCCCCTGGGTCCGGGTGTTCCGCCACCACCTGGTGCCCCGACCGGCCGGTGCCGCCGCC
CCCGCCGGCGAGCCGCCCGCCTGGGAGGTGGTCGGCCCGCTGGCCGGGCACCCGCACGCC
GAGGCGGTGCGGACCGCGTTCCGGGTGGACGCCGGGGCGCCGGCGGGCCGGCTGCTCGCC
CTGCCGCCAGGGCTGGCCGACATCCCGACCGCCGACGTGGTCGCCGCGCTGCGCGCCGCG
GCGGGCGACCGGCGGCCGCTCGTGGTGCTGCACCACGGCGGGGTCGGCGCGGCCGTCGGC
CGCAGCCTGGCCGTGGAGACCGGAGCGCCGGTGCTGGTGGTGGAGACCCCGCCGGGCCCG
GCCGGCGTCCGGCTGGCCGCCGTCGAGGCGTCCCGGCCGTGGTCCGGCTACCAGGAGGTC
GTGTACGGCGCGGACGGCGTACGCACCGTGCCGGTCACCCGGCTGCTGGACGGGCAGCCC
CGCACCGACCGGCGGATCCCGCTCGGCCCGGGCGAGGTCTGCCTGGTCACCGGGGGCGCG
AAGGGGATCGGGGCGGCCTGCGCGGCGGCCCTCGGCGAGGCCACCGGGGCGCGGCTCGTG
CTCTTCGGCCGCAGCCCCGCCGACGATCCGGAGGTGGTCGAGGCGGTCCGCCGCACCGGC
GCGGTCTACCGGTCGGTCGACCTGGCCGACCCGGTGGCGGTGGCCGCGGCGGTCACCGCC
GTCCGCGCCGAGCACGGCCCGGTGCGCGGCCTGCTGCACGCGGCCGGGCGCAACGAGCCG
GCGCCGGTGACCGACCTGACCGCCGAGGAGCTGCACCGCACCCTCGCCCCGAAGGCGTAC
GGCTTCGAGCACGTGGTGGCCGCGCTCGACCCCGACGAGCTGCGCTTCGCCGTGGCGTTC
GGCTCGGTGATCGGCCGCGCCGGACTTCCCGGCGAGGCGGCGTACGCCACCGCCAACGAG
TACCTCTCCCGGCGCTGCGCGGAGCTGGCCGCGACCGTGCCGCAGGTGCGCTGGCTGAGC
ATCGAGTGGTCGGTCTGGTCCGGGACCGGGATGGGCGTCCGGCTCGGCGTGCTCGACGGG
CTGCTGCGGCGCGGGGTCAGCCCCATCCCGCCCGACGAGGGCACCCGCCTGCTGCTGGAA
CTGCTCGCCACGCCGGCGCTGCCGCCGGTGGTGCTGGTGGCCGGCCGGCTGCCGGTGAGC
GACACCCTGGAGTGGGACGAGTGCGCCGAGGAGCACGGCCGTTTCCTGGAGTCACGGCTG
GTCGGCACGCCCTGCGTCGAGCTGGTCAGCGAGGCCCGGCTCTCCCTCGGCGCCGACCCC
TACCTGGACGACCACCGGATCGACGGCGCGGCGGTGCTCCCGGCCGTGCTCGGGCTGGAG
GCCATGGCCCAGGCCGCCGCCGCGCTCGGCGCGAAGCAGGTGCCCACGGTGATCCGGGAC
GTGGCGCTGACCCGCCCGGTGACGGTCGGCGACCGGGAGCCCCGGCCGGTCCGGGTGGCC
GCGCTGACCGGCGCCGACGGCACCGTCCGGGCGGCGGTGCGCAGCGCGGAGACCGGCTTC
GCCGTGGACCACCTCACCGGCACGTACGGCGGGGCGGTGACCTCGGGCGAGCCGGTGCCG
CCGCCCTCCACCGGGCTGCTGGTGCCCGGCGGGCCGCTCTACGGCCCGGCCTTCTTCCAC
GGCCCCCGGTTCCGGCGGGTGGCCGGCTACCACGGGCTGAGCGCCTACCGGTGCGTGGCG
GAGGTGCACGCCGAGGCGGGGACCTGGTTCGGCGGTTTCCACGACCAGCGGCTGCAACTG
GGCGACCCGGGGGTGCGGGACGCCTTCCTGCACCTGCTCCAGGCGTGCGTGCCGGACCGG
CGGGTGCTGCCCGTCGGGGTGGACCGGATCGACATCCACGCCCGCCCGGAGGGCACCCTG
ACCGTCCACGCCCGGCAGGTGGCCGAGGCGGGCGACGAGTTCCGCTTCGACGTCACAGTC
ATCGACGCGGACGGCTCGCCGGTGGAGCGCTGGACCGGGCTGCGGCTGCGCGCGGTCGGC
CCGGTGGAGAACGCCGTGTGGCCGGCCGAGCTGGTCGGGCCGCTGGTGACCCGGCGGCTG
CGCCGCTGGCGGCCGGAACTGCGGGTGGACCTGGCCGCCGCGCCGGCCGGGCGGGGCGAC
CGGGAACGCAGCCGGGCGCTGGCCGGCTGGCTGCTCGGCGGCGAGGTACGCGCCGACGCC
ACCGGCCGGCTCCGGCCCGGCGTACCGGCCACGCCGCTGGGGTGGCGCGGGATCAGCGTC
AGCCACCTCGACGGGCACCTGCTGACCGCCGCGGCGGACCGCCCGGTCGGGGTCGACTGG
GAGGTCGTCACCCCCACCCCACCGTTGCCCGAGGCGGCGGCGCGGGTCGCCGAGGCGCTG
GCCCGGCTCACCGGCGAGGACGCGGCCACCGCCGGCACCCGGGTGTGGACGGCGCTGGAG
GCGCTGGTGAAGGCGGGCGCCGCAGTCGACGTACCGCTGGTGCTGCGCGACGAGACCGGG
CCGGACGGCTGGGTGGCGCTGCACGCCGGCCGGCACGCGGTCTACGGGACGGTCGTGCCG
GCGACACCCGGGCCGATCGCGGTGAGCCTGGCCGTCGCCGTGGACGCCGACGGGGAGGGG
TGA
[1] KS4..408
[1] AT617..815
[1] acetyl-CoA malonyl-CoA750..754
[1] ACP917..1011
[1] KR1194..1368
[1] DH1438..1587
[1] PPT1685..1891
[1] KS10..1224
[1] AT1849..2445
[1] acetyl-CoA malonyl-CoA2248..2262
[1] ACP2749..3033
[1] KR3580..4104
[1] DH4312..4761
[1] PPT5053..5673

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001227 Acyl transferase domain (Domain)
 [617-680]  2.99999999999998e-36 G3DSA:3.40.366.10 [749-836]  2.99999999999998e-36 G3DSA:3.40.366.10
G3DSA:3.40.366.10   Ac_transferase_reg
IPR009081 Acyl carrier protein-like (Domain)
 [925-1037]  1e-11 SSF47336
SSF47336   ACP_like
 [933-1005]  1.2e-06 G3DSA:1.10.1200.10
G3DSA:1.10.1200.10   ACP_like
IPR013968 Polyketide synthase, KR (Domain)
 [1194-1368]  1.29999999999998e-33 PF08659
PF08659   KR
IPR014030 Beta-ketoacyl synthase, N-terminal (Domain)
 [4-283]  1.2e-50 PF00109
PF00109   ketoacyl-synt
IPR014031 Beta-ketoacyl synthase, C-terminal (Domain)
 [295-408]  1.2e-33 PF02801
PF02801   Ketoacyl-synt_C
IPR014043 Acyl transferase (Domain)
 [617-815]  1.3e-26 PF00698
PF00698   Acyl_transf_1
IPR016035 Acyl transferase/acyl hydrolase/lysophospholipase (Domain)
 [572-862]  4.60000044330862e-36 SSF52151
SSF52151   Acyl_Trfase/lysoPlipase
IPR016036 Malonyl-CoA ACP transacylase, ACP-binding (Domain)
 [686-749]  3.0999994589937e-11 SSF55048
SSF55048   Malonyl_transacylase_ACP-bd
IPR016038 Thiolase-like, subgroup (Domain)
 [6-124]  1.70000000000001e-59 G3DSA:3.40.47.10 [157-300]  1.70000000000001e-59 G3DSA:3.40.47.10 [301-455]  1.5e-47 G3DSA:3.40.47.10
G3DSA:3.40.47.10   Thiolase-like_subgr
IPR016039 Thiolase-like (Domain)
 [3-405]  3.10001307370206e-63 SSF53901
SSF53901   Thiolase-like
IPR016040 NAD(P)-binding domain (Domain)
 [1191-1403]  1.99999999999999e-32 G3DSA:3.40.50.720
G3DSA:3.40.50.720   NAD(P)-bd
SignalP No significant hit
TMHMM No significant hit