close all open/close all

CDS information : Dynm_00190


close this sectionLocation

Organism
StrainATCC 53710 (=NBRC 15963)
Entry nameDynemicin
Contig
Start / Stop / Direction32,556 / 32,990 / + [in whole cluster]
32,556 / 32,990 / + [in contig]
Location32556..32990 [in whole cluster]
32556..32990 [in contig]
TypeCDS
Length435 bp (144 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category1.4 Other
Productputative thioesterase
Product (GenBank)DynE7
GenedynE7
Gene (GenBank)
EC number
Keyword
  • TEBC family
  • enediyne core
Note
  • Similar to Hotdog-fold thioesterase.
Note (GenBank)
  • putative thioesterase
Reference
ACC
PmId
[18328078] The biosynthetic genes encoding for the production of the dynemicin enediyne core in Micromonospora chersina ATCC53710. (FEMS Microbiol Lett. , 2008)
[20888341] Induced-fit upon ligand binding revealed by crystal structures of the hot-dog fold thioesterase in dynemicin biosynthesis. (J Mol Biol. , 2010)
[12536216] A genomics-guided approach for discovering and expressing cryptic metabolic pathways. (Nat Biotechnol. , 2003)
Related Reference
ACC
Q8KNG2
NITE
Calm_00350
PmId
[19357082] Structure and catalytic mechanism of the thioesterase CalE7 in enediyne biosynthesis. (J Biol Chem. , 2009)

close this sectionSequence

selected fasta
>putative thioesterase [DynE7]
MPDSYVHRHVVTFDETNLVGNVYFAHYLHWQGHCREHFLADHAPGVMAALADGLALVTVD
CHADFYAEGSAFDEVEVRMMLDRLDGHRIAMSFDYVRVAPGPPTLLAQGRQTVACMRRAG
HGLEPVEVPAELRRALSRYAVVAR
selected fasta
>putative thioesterase [DynE7]
ATGCCCGACAGCTACGTCCACCGGCACGTGGTGACCTTCGACGAGACGAACCTCGTGGGG
AACGTCTACTTCGCCCACTACCTGCACTGGCAGGGCCACTGCCGGGAGCACTTCCTGGCC
GACCACGCGCCCGGCGTCATGGCCGCGCTGGCCGACGGGCTGGCCCTGGTGACCGTCGAC
TGCCACGCCGACTTCTACGCCGAGGGCAGCGCCTTCGACGAGGTCGAGGTGCGGATGATG
CTGGACCGGCTGGACGGCCACCGGATCGCGATGTCCTTCGACTACGTCCGGGTGGCGCCC
GGCCCGCCGACGCTGCTGGCGCAGGGCCGGCAGACGGTGGCCTGCATGCGCCGGGCCGGG
CACGGCCTGGAACCGGTCGAGGTGCCGGCCGAGCTGCGCCGGGCGCTGAGCCGGTACGCG
GTGGTGGCCCGATGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
No significant hit
SignalP No significant hit
TMHMM No significant hit