close all open/close all

CDS information : Dynm_00200


close this sectionLocation

Organism
StrainATCC 53710 (=NBRC 15963)
Entry nameDynemicin
Contig
Start / Stop / Direction32,987 / 33,646 / + [in whole cluster]
32,987 / 33,646 / + [in contig]
Location32987..33646 [in whole cluster]
32987..33646 [in contig]
TypeCDS
Length660 bp (219 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.4 hypothetical protein
Producthypothetical protein
Product (GenBank)DynS6
GenedynS6
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)
  • NADP oxidoreductase coenzyme F420-dependent
Reference
ACC
PmId
[18328078] The biosynthetic genes encoding for the production of the dynemicin enediyne core in Micromonospora chersina ATCC53710. (FEMS Microbiol Lett. , 2008)

close this sectionSequence

selected fasta
>hypothetical protein [DynS6]
MTVGIVGRGRMGRGLAEAVRQAGLHPLLVPGRADPRRVADLLDRAALVVLAVPFPAAVEF
LRGPAGRRGRGRTLVDPTNPVFCEPPVVPPGRSGGELLAELAADRASGPDHPGEGWRVAK
AFNTVPAGVLARCRVNGLPVSLPVAADHPAALRDVFALARALGFAPLDAGGIRTARHLEA
LTGLLMAVSDRQGLRGQVSIHIGVPSGDRTVWEPACRAG
selected fasta
>hypothetical protein [DynS6]
ATGACCGTCGGCATCGTGGGCCGGGGCCGGATGGGCCGGGGCCTGGCCGAGGCGGTCCGG
CAGGCCGGCCTCCACCCCCTCCTGGTGCCGGGCCGGGCCGACCCGCGCCGGGTGGCCGAC
CTGCTCGACCGGGCCGCGCTTGTGGTGCTCGCGGTGCCGTTCCCCGCCGCGGTCGAGTTC
CTGCGGGGCCCGGCCGGGCGGCGCGGCCGGGGTCGCACCCTCGTCGACCCCACGAACCCG
GTGTTCTGCGAGCCGCCGGTGGTGCCGCCCGGCCGCTCCGGCGGCGAACTGCTGGCCGAA
CTCGCCGCCGACCGGGCCTCCGGCCCGGACCATCCGGGCGAGGGCTGGCGGGTGGCGAAG
GCGTTCAACACGGTGCCGGCCGGGGTGCTGGCCCGGTGCCGGGTCAACGGCCTGCCGGTG
TCGCTGCCGGTCGCCGCCGACCATCCGGCGGCGCTGCGGGACGTCTTCGCGCTGGCCCGG
GCACTGGGCTTCGCGCCACTGGACGCCGGGGGCATCCGCACGGCCCGCCACCTGGAGGCG
CTGACCGGGCTGCTGATGGCGGTCAGCGACCGGCAGGGCCTGCGCGGCCAGGTGTCCATC
CACATCGGCGTGCCGAGCGGCGACCGGACCGTGTGGGAGCCGGCGTGCCGGGCCGGCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR016040 NAD(P)-binding domain (Domain)
 [1-182]  1.5e-35 G3DSA:3.40.50.720
G3DSA:3.40.50.720   NAD(P)-bd
SignalP No significant hit
TMHMM No significant hit