close all open/close all

CDS information : Dynm_00220


close this sectionLocation

Organism
StrainATCC 53710 (=NBRC 15963)
Entry nameDynemicin
Contig
Start / Stop / Direction34,396 / 35,319 / + [in whole cluster]
34,396 / 35,319 / + [in contig]
Location34396..35319 [in whole cluster]
34396..35319 [in contig]
TypeCDS
Length924 bp (307 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.4 hypothetical protein
Producthypothetical protein
Product (GenBank)DynU6
GenedynU6
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)
  • putative transporter; CalU6-like protein
Reference
ACC
PmId
[18328078] The biosynthetic genes encoding for the production of the dynemicin enediyne core in Micromonospora chersina ATCC53710. (FEMS Microbiol Lett. , 2008)

close this sectionSequence

selected fasta
>hypothetical protein [DynU6]
MTALASSTRTEVPTTRRRPVAAVAGVLGGLVLAVLWSFEFVDHVIGDNVANSVLGTDAKQ
TAIAGSAAGVVFAFVSGFAGTFTACNIAVFGALPDVAECSAAPRRGRLAAALAPLGWLAL
GLVSVAAVYGFLAVLVGSRLPQLSTDTVGDGLPVRLVQASVVFGVIGLAFAWLGLAALGL
LPDPFAGRPVARLVTLGALVGGFLVGRPYPLFHKLLEQAVDSHNPFYGALVLVLQSLGNV
LIMAVLALLLVLGTRGAFQRWLSRPGRAALLVGVSLLALGAFLVFYWDVRLPAMFGYGWF
PTMPWNA
selected fasta
>hypothetical protein [DynU6]
ATGACCGCCCTCGCCAGCTCCACTCGTACCGAAGTTCCCACCACCCGGCGCCGCCCGGTC
GCCGCCGTCGCCGGCGTGCTCGGCGGCCTGGTGCTCGCCGTGCTCTGGTCGTTCGAGTTC
GTCGACCACGTGATCGGCGACAACGTCGCCAACTCGGTGCTCGGCACCGACGCCAAGCAG
ACCGCCATCGCCGGCTCCGCGGCCGGGGTGGTCTTCGCCTTCGTCTCCGGGTTCGCCGGA
ACGTTCACCGCCTGCAACATCGCCGTGTTCGGCGCGCTGCCGGACGTCGCCGAGTGCTCG
GCCGCGCCCCGCCGCGGCCGGCTGGCCGCCGCGCTGGCCCCGCTGGGCTGGCTGGCCCTC
GGGCTGGTGTCGGTGGCCGCCGTGTACGGCTTCCTGGCCGTCCTCGTCGGCTCCCGGCTG
CCGCAGCTCTCCACGGACACGGTCGGCGACGGCCTCCCGGTCCGGCTGGTCCAGGCGTCC
GTGGTGTTCGGCGTGATCGGGCTGGCCTTCGCCTGGCTCGGGCTGGCCGCCCTGGGCCTG
CTGCCCGACCCGTTCGCCGGCCGGCCGGTGGCCCGGCTCGTGACGCTTGGCGCGCTCGTC
GGCGGCTTCCTGGTGGGCCGCCCGTACCCGCTGTTCCACAAGTTGCTGGAGCAGGCCGTG
GACAGCCACAACCCGTTCTACGGCGCGCTCGTGCTGGTGCTCCAGTCGCTCGGCAACGTG
CTCATCATGGCGGTGCTGGCCCTGCTGCTGGTGCTCGGCACCCGGGGCGCGTTCCAGCGC
TGGCTGTCCCGCCCCGGCCGGGCCGCCCTGCTCGTCGGGGTCAGCCTGCTGGCGCTCGGC
GCGTTCCTGGTCTTCTACTGGGACGTCCGGCTGCCGGCCATGTTCGGCTACGGCTGGTTC
CCGACCATGCCGTGGAACGCCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
No significant hit
SignalP No significant hit
TMHMM
 [20-38]  Transmembrane (i-o) [71-93]  Transmembrane (o-i) [114-136]  Transmembrane (i-o) [160-182]  Transmembrane (o-i) [189-211]  Transmembrane (i-o) [231-253]  Transmembrane (o-i) [265-287]  Transmembrane (i-o)
Transmembrane 7