close all open/close all

CDS information : Dynm_00230


close this sectionLocation

Organism
StrainATCC 53710 (=NBRC 15963)
Entry nameDynemicin
Contig
Start / Stop / Direction37,166 / 35,283 / - [in whole cluster]
37,166 / 35,283 / - [in contig]
Locationcomplement(35283..37166) [in whole cluster]
complement(35283..37166) [in contig]
TypeCDS
Length1,884 bp (627 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category4.1 transcriptional regulator
Productputative transcriptional regulator
Product (GenBank)DynR2
GenedynR2
Gene (GenBank)
EC number
Keyword
  • SARP family
Note
Note (GenBank)
  • putative transcriptional regulator; CalR2-like protein
Reference
ACC
PmId
[18328078] The biosynthetic genes encoding for the production of the dynemicin enediyne core in Micromonospora chersina ATCC53710. (FEMS Microbiol Lett. , 2008)
Related Reference
ACC
Q2MGB3
NITE
Fred_00260
PmId
[18556785] Identification and utility of FdmR1 as a Streptomyces antibiotic regulatory protein activator for fredericamycin production in Streptomyces griseus ATCC 49344 and heterologous hosts. (J Bacteriol. , 2008)

close this sectionSequence

selected fasta
>putative transcriptional regulator [DynR2]
MGAAVDTVRIKVLGPVAAFRDTTEIPLGPSRQRAVLGYLALHPGQPVPVGALTEAVWGDD
APASGDQLVRTYVARLRQVLEPDTAPRARTNVIASVPGGYRLDVPPDRVDASHFQQLLGR
ARARQAAGAPHEAFELLDAALGLWQDPTLADLSGLLASPRHLTALRADWVDAGLRHVAVG
LSLGQASVVLPVAEQLAAVEPLQEAVQARYLEALTRSGQRAAAVHHYLSVRARLRAELGV
EPGPELRRMYAALLHAGDEPGPGVEPPSRAGADEPDRRPGWRGPGPAIGPLIGREDDVAR
CATLLVAHRAVTIVGPAGCGKSATGLAVAERVAAAFPDGVATVDAAEARDCGEVLRLLAE
TLELPGPNADPLRAVADKRMLLVLNDVEHLGSRAGEMVEHALHRCPRTAMLVTSRRRLGL
AHEAVFRLAPLPLPGTDAPDALPDNPAVRLFVHRAGLVRPGFRLAPADAVTVARICRGLD
GLPLAIELAAACLYTDSLDGVLRRVDDPLDELRPQRRGHPQHHRSLRAALHRSLAALAPV
ERACLARLAAGDRCFSRDEAAARCAGLVPPARLGAVLDRLVDESLLDARPGPGVPRYRLL
RTVALAAATVPESGEHQAFHGMVGNQP
selected fasta
>putative transcriptional regulator [DynR2]
ATGGGTGCTGCCGTGGACACTGTGCGGATAAAGGTGTTGGGCCCGGTCGCCGCGTTCCGT
GACACCACCGAGATCCCCCTGGGGCCGTCCCGGCAGCGTGCGGTCCTCGGCTACCTCGCC
CTGCACCCCGGGCAGCCGGTCCCGGTCGGCGCGCTCACCGAGGCGGTCTGGGGCGACGAC
GCCCCGGCCAGCGGCGACCAGCTCGTCCGGACGTACGTGGCGCGGCTGCGCCAGGTGCTG
GAGCCGGACACCGCGCCGCGCGCCCGGACCAACGTCATCGCCTCGGTGCCCGGCGGCTAC
CGGCTCGACGTGCCGCCGGACCGCGTCGACGCGTCGCACTTCCAGCAGCTGCTCGGCCGG
GCCCGGGCCCGGCAGGCGGCCGGCGCGCCGCACGAGGCCTTCGAGCTGCTCGACGCGGCG
CTCGGGCTCTGGCAGGACCCGACCCTCGCCGACCTCAGTGGCCTGCTGGCCAGCCCCCGG
CACCTCACCGCGCTGCGCGCCGACTGGGTCGATGCCGGCCTGCGCCACGTCGCCGTGGGG
CTGAGCCTCGGCCAGGCGTCGGTGGTGCTCCCGGTGGCCGAGCAGCTCGCGGCCGTCGAG
CCGCTCCAGGAGGCGGTGCAGGCCCGCTACCTGGAGGCGTTGACCCGCAGTGGGCAGCGG
GCCGCCGCCGTGCACCACTACCTGAGCGTCCGGGCCCGGCTCCGCGCCGAACTCGGTGTC
GAGCCCGGTCCGGAGCTGCGCCGGATGTACGCCGCCCTGCTGCACGCCGGGGACGAGCCG
GGGCCGGGCGTCGAACCGCCGTCCCGGGCCGGGGCGGACGAACCCGACCGGCGGCCCGGC
TGGCGCGGACCCGGCCCGGCGATCGGCCCGCTGATCGGCCGGGAGGACGACGTCGCCCGC
TGCGCCACGCTGCTCGTCGCGCACCGGGCCGTCACCATCGTCGGGCCGGCCGGCTGCGGC
AAGTCGGCCACCGGGCTGGCGGTCGCCGAACGCGTCGCCGCCGCGTTCCCCGACGGCGTG
GCCACTGTCGACGCGGCCGAGGCCCGGGACTGCGGCGAGGTGCTGCGGCTGCTGGCCGAG
ACGCTGGAACTGCCGGGGCCGAACGCCGACCCGCTGCGCGCCGTAGCCGACAAGCGGATG
CTGCTGGTGCTCAACGACGTCGAGCACCTCGGCTCGCGGGCCGGCGAGATGGTGGAGCAT
GCCCTGCACCGCTGCCCGCGCACGGCCATGCTGGTCACCTCCCGCCGCCGGCTCGGGCTC
GCCCACGAGGCGGTGTTCCGGCTCGCACCCCTGCCGCTGCCCGGGACCGATGCCCCGGAC
GCGCTGCCGGACAACCCGGCCGTGCGCCTCTTCGTCCACCGGGCCGGGCTGGTCCGGCCC
GGCTTCCGCCTCGCCCCGGCGGACGCGGTGACCGTGGCGCGTATCTGCCGCGGGCTGGAC
GGCCTGCCGCTGGCCATCGAACTGGCCGCCGCCTGCCTCTACACCGACAGCCTCGACGGG
GTGCTGCGCCGGGTCGACGACCCGCTGGACGAGTTGCGGCCACAGCGGCGCGGCCATCCG
CAGCACCACCGTTCGCTGCGCGCCGCGCTGCACCGCAGCCTGGCCGCGCTCGCCCCGGTC
GAGAGGGCCTGCCTGGCCCGCCTGGCCGCCGGTGACCGGTGCTTCTCGCGCGACGAGGCG
GCCGCCCGCTGCGCCGGCCTGGTCCCGCCGGCCCGGCTCGGGGCCGTGCTCGACCGGCTC
GTCGACGAGTCCCTGCTGGACGCCCGGCCCGGGCCGGGCGTCCCGCGGTACCGGCTCCTC
CGCACGGTGGCGCTGGCGGCGGCCACCGTGCCGGAGAGCGGGGAGCATCAGGCGTTCCAC
GGCATGGTCGGGAACCAGCCGTAG

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000767 Disease resistance protein (Family)
 [310-325]  3.00000067992871e-06 PR00364 [374-388]  3.00000067992871e-06 PR00364 [479-493]  3.00000067992871e-06 PR00364
PR00364   DISEASERSIST
IPR001867 Signal transduction response regulator, C-terminal (Domain)
 [30-102]  2.3e-13 PF00486
PF00486   Trans_reg_C
 [22-102]  1.20000117458134e-16 SM00862
SM00862   Trans_reg_C
IPR003593 AAA+ ATPase domain (Domain)
 [307-435]  6.40000038788486e-06 SM00382
SM00382   AAA
IPR005158 Bacterial transcriptional activator domain (Domain)
 [109-254]  6.39998633403535e-34 SM01043
SM01043   BTAD
 [109-254]  6.19999999999999e-30 PF03704
PF03704   BTAD
IPR011991 Winged helix-turn-helix transcription repressor DNA-binding (Domain)
 [19-105]  7.59999999999999e-13 G3DSA:1.10.10.10
G3DSA:1.10.10.10   Wing_hlx_DNA_bd
IPR016032 Signal transduction response regulator, C-terminal effector (Domain)
 [7-103]  8.60000664726925e-16 SSF46894
SSF46894   Bipartite_resp_reg_C-effector
SignalP No significant hit
TMHMM No significant hit