close all open/close all

CDS information : Dynm_00240


close this sectionLocation

Organism
StrainATCC 53710 (=NBRC 15963)
Entry nameDynemicin
Contig
Start / Stop / Direction37,274 / 38,638 / + [in whole cluster]
37,274 / 38,638 / + [in contig]
Location37274..38638 [in whole cluster]
37274..38638 [in contig]
TypeCDS
Length1,365 bp (454 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.4 hypothetical protein
Producthypothetical protein
Product (GenBank)DynR3
GenedynR3
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)
  • predicted protein kinase
Reference
ACC
PmId
[18328078] The biosynthetic genes encoding for the production of the dynemicin enediyne core in Micromonospora chersina ATCC53710. (FEMS Microbiol Lett. , 2008)

close this sectionSequence

selected fasta
>hypothetical protein [DynR3]
MMLPENPLPGDRPAGLSRTIPRQSRLALATRGAFVVASSAAHLLPAAAGAAVLRPLRGRT
AAARFFYRRLVRHLQRLGPAPVKFGQIMGTRRDLLPPLLCDELGRLHDRVRPMSGRQVRR
ALREAYGPDLSRHFTEVETTARASGSIAGVYRAVRPDGREVALKLQRPGIRRRMALDLAL
IHGAAALAEKLPPGRGVPLAELTGFVCAAVLGQLDFAGERTNLAELRRNFAESDNVWIPA
TLPELCRPNCLAMEFIPDLVARPVAEIDPARRPRLAARTVSAVYQMLFLDGFVHCDLHPG
NVYFKGPRVVVLDAGFSIRLDPTVRRQFADFFLGLALGRGRQCGEVVVDSAVRVAPDADV
DGFIGRVAELVKRNTGVPAKEFQLTRFGTELFTLQRDFGLYAASEFVFPLLSLLVIEGTV
RDLDPDIDFQAAARPMLLRAAAETAHLAPQRRAG
selected fasta
>hypothetical protein [DynR3]
TTGATGCTCCCGGAGAACCCCCTCCCCGGCGACCGCCCCGCCGGACTCTCCCGCACCATC
CCCCGCCAGTCCCGCCTGGCCCTGGCCACCCGTGGCGCGTTCGTGGTGGCCAGCAGCGCC
GCACACCTGCTGCCCGCGGCGGCCGGCGCGGCGGTGCTGCGACCCCTGCGCGGCCGCACC
GCGGCGGCCCGCTTCTTCTACCGCCGGCTGGTCCGGCACCTGCAACGACTCGGCCCGGCG
CCGGTCAAGTTCGGCCAGATCATGGGCACCCGGCGGGACCTCCTGCCGCCCCTGCTCTGC
GACGAGCTGGGCCGGCTGCACGACCGGGTCCGGCCGATGTCCGGCCGGCAGGTGCGCCGC
GCGCTGCGCGAGGCGTACGGGCCGGACCTGAGCCGGCACTTCACCGAGGTCGAGACGACG
GCGCGGGCCAGCGGCAGCATCGCCGGCGTCTACCGGGCCGTCCGGCCGGACGGCCGGGAG
GTGGCGCTGAAGCTGCAACGCCCCGGCATCCGCCGCCGGATGGCGCTCGACCTGGCCCTC
ATCCACGGCGCGGCGGCGCTGGCGGAGAAGCTGCCGCCGGGCCGCGGGGTGCCGCTGGCC
GAGCTGACCGGTTTCGTCTGCGCGGCAGTGCTCGGGCAGCTCGACTTCGCCGGCGAACGG
ACCAACCTGGCCGAGCTGCGGCGCAACTTCGCCGAGTCCGACAACGTGTGGATCCCGGCG
ACGCTCCCGGAGCTGTGCCGGCCCAACTGCCTGGCCATGGAGTTCATCCCGGACCTGGTG
GCCCGCCCGGTCGCCGAGATCGATCCGGCCCGCCGGCCCCGGCTGGCCGCCCGCACCGTG
AGCGCGGTCTACCAGATGCTCTTCCTGGACGGCTTCGTCCACTGTGACCTGCACCCGGGG
AACGTCTACTTCAAGGGACCCCGGGTGGTCGTGCTGGACGCCGGGTTCAGCATCCGGCTC
GACCCGACCGTACGCCGGCAGTTCGCCGACTTCTTCCTCGGCCTGGCGCTGGGACGGGGC
CGGCAGTGCGGCGAGGTGGTGGTGGACAGCGCGGTCCGGGTGGCGCCCGACGCGGACGTC
GACGGCTTCATCGGCCGGGTCGCCGAGCTGGTCAAGCGGAACACCGGGGTGCCGGCCAAG
GAGTTCCAGCTCACCCGCTTCGGCACCGAACTGTTCACCCTGCAACGGGACTTCGGCCTG
TACGCCGCGTCCGAGTTCGTCTTCCCGCTGCTGTCGCTGCTGGTGATCGAGGGGACCGTC
CGCGACCTCGACCCCGACATCGACTTCCAGGCGGCGGCCCGCCCGATGCTGCTGCGCGCC
GCCGCCGAGACCGCCCACCTGGCCCCGCAGCGCCGGGCCGGCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR004147 UbiB domain (Domain)
 [125-240]  2.1e-22 PF03109
PF03109   ABC1
IPR011009 Protein kinase-like domain (Domain)
 [113-332]  2.89999717862184e-15 SSF56112
SSF56112   Kinase_like
SignalP No significant hit
TMHMM No significant hit