close all open/close all

CDS information : Dynm_00260


close this sectionLocation

Organism
StrainATCC 53710 (=NBRC 15963)
Entry nameDynemicin
Contig
Start / Stop / Direction39,223 / 39,798 / + [in whole cluster]
39,223 / 39,798 / + [in contig]
Location39223..39798 [in whole cluster]
39223..39798 [in contig]
TypeCDS
Length576 bp (191 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.4 hypothetical protein
Producthypothetical protein
Product (GenBank)unkown protein
GenedynU20
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)
  • ORF16
Reference
ACC
PmId
[18328078] The biosynthetic genes encoding for the production of the dynemicin enediyne core in Micromonospora chersina ATCC53710. (FEMS Microbiol Lett. , 2008)

close this sectionSequence

selected fasta
>hypothetical protein [unkown protein]
MTSADPRRGVALRRVPAALVLLIGAVVLLRPLFRVPEDPVVTATPARGAVLAAAPPAVEL
AFGSRPRRGDAHVTVTAAAGQRVDRGVATIQGTGVRETLPPLDEGWYVVAYHVTLTDGSE
PSGAYAFAVGRPAGPPPPVDADAAAPAEAEGHAGHAGPPDPLTLAVLAANAVVLVVLGAR
LVWWRRRRRSG
selected fasta
>hypothetical protein [unkown protein]
ATGACCTCAGCGGATCCCCGCCGGGGCGTGGCGCTGCGCCGCGTCCCGGCGGCGCTGGTG
CTGCTGATCGGCGCGGTGGTGCTGCTGCGGCCGCTGTTCCGGGTGCCGGAGGACCCGGTG
GTGACCGCCACGCCGGCCCGCGGGGCGGTGCTCGCCGCCGCCCCGCCGGCCGTGGAGCTG
GCCTTCGGCAGCCGCCCTCGCCGGGGCGACGCGCACGTCACGGTCACCGCCGCCGCCGGG
CAGCGGGTCGATCGCGGCGTGGCCACGATCCAGGGCACGGGGGTACGCGAGACGCTGCCC
CCGCTCGACGAGGGCTGGTACGTGGTGGCGTACCACGTGACCCTCACCGACGGGTCCGAG
CCCAGCGGCGCGTACGCCTTCGCGGTCGGCCGTCCGGCGGGCCCGCCGCCACCGGTGGAC
GCCGACGCGGCGGCGCCCGCGGAGGCCGAGGGCCACGCCGGCCACGCCGGGCCGCCCGAT
CCGCTGACCCTGGCGGTGCTGGCCGCCAACGCCGTGGTGCTGGTGGTGCTGGGCGCCCGG
CTGGTCTGGTGGCGACGCCGCCGGAGGTCCGGATGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR007348 CopC domain (Domain)
 [40-129]  8.1e-15 PF04234
PF04234   CopC
IPR014755 Copper resistance protein CopC/internalin, immunoglobulin-like (Domain)
 [40-129]  3.2e-14 G3DSA:2.60.40.1220
G3DSA:2.60.40.1220   Cu-resist/internalin_Ig-like
IPR014756 Immunoglobulin E-set (Domain)
 [37-130]  2.00000075217457e-16 SSF81296
SSF81296   Ig_E-set
SignalP No significant hit
TMHMM
 [12-34]  Transmembrane (i-o) [162-184]  Transmembrane (o-i)
Transmembrane 2