close all open/close all

CDS information : Dynm_00270


close this sectionLocation

Organism
StrainATCC 53710 (=NBRC 15963)
Entry nameDynemicin
Contig
Start / Stop / Direction41,045 / 39,828 / - [in whole cluster]
41,045 / 39,828 / - [in contig]
Locationcomplement(39828..41045) [in whole cluster]
complement(39828..41045) [in contig]
TypeCDS
Length1,218 bp (405 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.4 hypothetical protein
Producthypothetical protein
Product (GenBank)unkown protein
Geneorf14
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)
  • ORF17
Reference
ACC
PmId
[18328078] The biosynthetic genes encoding for the production of the dynemicin enediyne core in Micromonospora chersina ATCC53710. (FEMS Microbiol Lett. , 2008)

close this sectionSequence

selected fasta
>hypothetical protein [unkown protein]
MREAGSGRSPAPARPPRPPRPGRGNPKERRQSEVGMPVDDRSAPAPRLEPRPGFTGVAPD
DFPLLHRNGGYPLAQDRWERLVSQVHIPAPADRVWSALTDPEQVAQWLAVCRGGWATADG
EAILDFEDGEFFFCRIRDVREPASGGEGRLSYLWRWVGVGPATEVTWQLTATPHGTQVTV
VEEAFNPPSDWRSWNGMGWPGILDQLADFIRTGVPWRWPWRRMGPYVQTELPGTTFEVWG
LLTSTPATQFWLSRTSGSLDAGSEVGLILGDASGVATMTVTRHVEAYQQFPSYLPRLEFR
LGRPGWPGELEGHLWIEPAGLGGSIIQVFHSNWEALSTIAPPLDERKILTGYWVGAFGRA
ALLCQRAFGDSFPAAPPGRDLDIPADLNGTGNGQRVDAGPHGWSR
selected fasta
>hypothetical protein [unkown protein]
GTGCGGGAGGCCGGCTCCGGCCGGTCTCCCGCACCGGCACGACCGCCCCGCCCACCACGG
CCGGGGCGCGGCAACCCGAAGGAGCGACGACAGTCGGAGGTTGGCATGCCCGTGGACGAC
CGGAGCGCACCCGCTCCCCGGCTGGAGCCCCGACCGGGCTTCACCGGGGTCGCACCCGAT
GACTTCCCGCTGCTGCACCGCAACGGCGGCTACCCGCTGGCCCAGGACCGCTGGGAGCGG
CTGGTCAGCCAGGTCCACATCCCCGCGCCCGCCGACCGGGTCTGGTCGGCGCTCACCGAT
CCGGAGCAGGTCGCGCAGTGGCTCGCGGTCTGCCGGGGCGGGTGGGCCACCGCCGACGGC
GAGGCGATCCTCGACTTCGAGGACGGGGAGTTCTTCTTCTGCCGGATCCGGGACGTGCGG
GAGCCGGCCTCGGGCGGCGAGGGCCGGCTGTCGTACCTCTGGCGCTGGGTGGGGGTGGGC
CCGGCCACCGAGGTGACCTGGCAGCTCACCGCGACGCCGCACGGCACCCAGGTCACCGTC
GTCGAGGAGGCGTTCAACCCGCCGTCGGACTGGCGGTCCTGGAACGGCATGGGCTGGCCC
GGCATCCTCGACCAGCTCGCCGACTTCATCCGCACCGGGGTGCCGTGGCGCTGGCCCTGG
CGGCGGATGGGCCCCTACGTGCAGACCGAGCTGCCCGGCACCACCTTCGAGGTCTGGGGG
CTGCTCACCTCGACCCCCGCCACCCAGTTCTGGCTCAGCCGCACCAGCGGCAGCCTGGAC
GCCGGCAGCGAGGTCGGCCTGATTCTCGGTGACGCCAGCGGGGTGGCCACCATGACGGTC
ACCCGGCACGTCGAGGCGTACCAGCAGTTCCCGTCGTACCTGCCGCGGCTGGAGTTCCGC
CTCGGGCGGCCGGGCTGGCCGGGTGAGCTGGAGGGGCACCTCTGGATCGAGCCGGCCGGG
CTGGGCGGCAGCATCATCCAGGTCTTCCACTCCAACTGGGAGGCGCTGAGCACGATCGCC
CCGCCGCTGGACGAACGCAAGATCCTCACCGGCTACTGGGTGGGCGCGTTCGGCCGGGCC
GCGCTGCTCTGCCAGCGGGCGTTCGGTGACTCGTTCCCGGCGGCGCCGCCCGGCCGGGAC
CTGGACATCCCGGCCGACCTGAACGGCACCGGGAACGGTCAGCGGGTCGACGCCGGCCCG
CACGGCTGGAGCCGGTAG

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR013538 Activator of Hsp90 ATPase homologue 1-like (Family)
 [88-209]  1.7e-15 PF08327
PF08327   AHSA1
IPR023393 START-like domain (Domain)
 [80-211]  1.99999999999999e-25 G3DSA:3.30.530.20
G3DSA:3.30.530.20   G3DSA:3.30.530.20
SignalP No significant hit
TMHMM No significant hit