close all open/close all

CDS information : Dynm_00280


close this sectionLocation

Organism
StrainATCC 53710 (=NBRC 15963)
Entry nameDynemicin
Contig
Start / Stop / Direction41,687 / 41,055 / - [in whole cluster]
41,687 / 41,055 / - [in contig]
Locationcomplement(41055..41687) [in whole cluster]
complement(41055..41687) [in contig]
TypeCDS
Length633 bp (210 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.4 hypothetical protein
Producthypothetical protein
Product (GenBank)unkown protein
Geneorf15
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)
  • ORF18
Reference
ACC
PmId
[18328078] The biosynthetic genes encoding for the production of the dynemicin enediyne core in Micromonospora chersina ATCC53710. (FEMS Microbiol Lett. , 2008)

close this sectionSequence

selected fasta
>hypothetical protein [unkown protein]
MSTKSVLFGRPVQTEGVPNVYAGAPVVPWTPPEPGIDNLGINSIDTFAVPGVGEYTVAFD
GWVRVVRSPSTSGEWADAEVYTNLIEMKMVGECEELGKITVTLNPDCLSAGQIRTPFDPY
AGEGPSAKACRMAVGAIFDMPKLGLKLMNREPIILTIDDVRSIPPAGAPGKGQIYRMMPL
LDVNDPDGQPVAYLTSLRFNMGGYLKPDQM
selected fasta
>hypothetical protein [unkown protein]
ATGAGCACCAAGAGCGTTCTTTTCGGTCGCCCGGTCCAGACCGAGGGCGTGCCGAACGTC
TACGCCGGCGCCCCGGTCGTCCCGTGGACCCCGCCGGAGCCCGGCATCGACAACCTGGGC
ATCAACTCGATCGACACCTTCGCGGTGCCGGGCGTGGGCGAGTACACGGTCGCCTTCGAC
GGCTGGGTGCGGGTGGTCCGGTCGCCGTCCACCTCGGGCGAGTGGGCCGACGCCGAGGTC
TACACCAACCTCATCGAGATGAAGATGGTCGGTGAGTGCGAGGAGCTCGGCAAGATCACC
GTCACGCTCAACCCGGACTGCCTCTCGGCCGGCCAGATCCGCACCCCGTTCGACCCGTAC
GCGGGTGAGGGGCCGTCGGCCAAGGCCTGCCGGATGGCGGTCGGCGCGATCTTCGACATG
CCGAAGCTCGGGCTGAAGCTGATGAACCGCGAGCCGATCATCCTGACCATCGACGACGTG
CGCAGCATCCCGCCGGCGGGCGCCCCGGGCAAGGGCCAGATCTACCGGATGATGCCGCTG
CTCGACGTCAACGACCCGGACGGCCAGCCGGTCGCGTACCTGACCAGCCTCCGGTTCAAC
ATGGGCGGCTACCTGAAGCCCGACCAGATGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro No significant hit
SignalP No significant hit
TMHMM No significant hit