close all open/close all

CDS information : Dynm_00290


close this sectionLocation

Organism
StrainATCC 53710 (=NBRC 15963)
Entry nameDynemicin
Contig
Start / Stop / Direction43,034 / 41,709 / - [in whole cluster]
43,034 / 41,709 / - [in contig]
Locationcomplement(41709..43034) [in whole cluster]
complement(41709..43034) [in contig]
TypeCDS
Length1,326 bp (441 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.4 hypothetical protein
Producthypothetical protein
Product (GenBank)PBS lyase HEAT-like repeat protein
Geneorf16
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)
  • ORF19
Reference
ACC
PmId
[18328078] The biosynthetic genes encoding for the production of the dynemicin enediyne core in Micromonospora chersina ATCC53710. (FEMS Microbiol Lett. , 2008)

close this sectionSequence

selected fasta
>hypothetical protein [PBS lyase HEAT-like repeat protein]
MAIDLCNKSPGALAEGAQGAWEEAVPADAAPVNLDALTADQRDALNFSYRTTLPAMDPRF
VAGDPAAWASDFGYALNKVAVRLDNRTNQELRDAALNHPDAAMREQALFEYADRDLPDAI
ELLGQAVLHDPNREVRWDALWAIEKLGGAHAVASLSKFAKDADPEIAEWSHLFRSELQTG
DPAFDGRAGKFTPGRTFDETIYLLIHCDLYVRLDDSNQHWGKISLAPQGLARIYGQAHAC
PNVATRERQLVIAKTIDGLHADGSPHCDNYLFRGFTDRTRRDRGNFFFESLVPRTFFKSG
HADDPSEGTRQANIGFARYGTWHLDPKFQIHDEAAIRYVRGRFQGWGYINLARIAGRSME
EILQPGNGVLSTLHDPEIGHMTNAFILGTFKGKLNDWDGDGVIDMNSRDVYSTVDGEIDM
NQDGVADQPGLTCCDHTTLLP
selected fasta
>hypothetical protein [PBS lyase HEAT-like repeat protein]
ATGGCAATCGATCTCTGCAACAAGTCGCCGGGTGCTCTCGCGGAGGGCGCCCAGGGTGCG
TGGGAGGAGGCGGTCCCGGCCGACGCGGCACCGGTCAACCTGGACGCCCTCACCGCGGAC
CAGCGCGACGCGCTCAACTTCTCCTACCGGACCACGCTGCCGGCGATGGACCCGCGCTTC
GTCGCCGGTGACCCGGCGGCCTGGGCGAGCGACTTCGGGTACGCGCTGAACAAGGTCGCG
GTCCGGCTGGACAACCGCACCAACCAGGAACTGCGCGACGCCGCGCTGAACCACCCCGAC
GCGGCCATGCGCGAGCAGGCCCTGTTCGAGTACGCCGACCGCGACCTGCCGGACGCGATC
GAGCTGCTCGGCCAGGCCGTGCTGCACGACCCCAACCGCGAGGTCCGCTGGGACGCGCTG
TGGGCCATCGAGAAGCTGGGCGGCGCCCACGCGGTCGCCAGCCTCAGCAAGTTCGCCAAG
GACGCGGACCCGGAGATCGCCGAGTGGTCGCACCTGTTCCGCAGCGAGCTGCAGACGGGT
GACCCGGCGTTCGACGGCCGGGCCGGCAAGTTCACCCCGGGCCGCACCTTCGACGAGACC
ATCTACCTGCTGATCCACTGCGACCTGTACGTGCGGCTGGACGACTCCAACCAGCACTGG
GGCAAGATCTCGCTGGCCCCGCAGGGCCTGGCCCGGATCTATGGCCAGGCGCACGCCTGC
CCGAACGTGGCGACCCGCGAGCGGCAGCTGGTGATCGCCAAGACCATCGACGGGCTGCAC
GCCGACGGCTCGCCGCACTGCGACAACTACCTGTTCCGCGGGTTCACCGACCGCACCCGC
CGGGACCGGGGGAACTTCTTCTTCGAGTCGCTGGTGCCCCGGACGTTCTTCAAGTCCGGT
CACGCCGACGACCCGAGCGAGGGCACCCGCCAGGCCAACATCGGCTTCGCCCGGTACGGC
ACCTGGCACCTCGACCCGAAGTTCCAGATCCACGACGAGGCGGCCATCCGCTACGTCCGT
GGTCGCTTCCAGGGCTGGGGCTACATCAACCTGGCCCGGATCGCCGGCCGCTCCATGGAG
GAGATCCTCCAGCCGGGCAACGGCGTGCTCTCCACGCTGCACGACCCGGAGATCGGCCAC
ATGACCAACGCGTTCATCCTCGGCACCTTCAAGGGGAAGCTGAACGACTGGGACGGCGAC
GGGGTCATCGACATGAACTCGCGCGACGTCTACTCGACCGTCGACGGCGAGATCGACATG
AACCAGGACGGCGTGGCGGACCAGCCCGGCCTGACCTGCTGCGACCACACCACCCTGCTG
CCGTAA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR011989 Armadillo-like helical (Domain)
 [94-166]  2.1e-10 G3DSA:1.25.10.10
G3DSA:1.25.10.10   ARM-like
IPR016024 Armadillo-type fold (Domain)
 [95-176]  6.899999633797e-09 SSF48371
SSF48371   ARM-type_fold
SignalP No significant hit
TMHMM No significant hit