close all open/close all

CDS information : Dynm_00300


close this sectionLocation

Organism
StrainATCC 53710 (=NBRC 15963)
Entry nameDynemicin
Contig
Start / Stop / Direction43,124 / 44,674 / + [in whole cluster]
43,124 / 44,674 / + [in contig]
Location43124..44674 [in whole cluster]
43124..44674 [in contig]
TypeCDS
Length1,551 bp (516 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.1 general function
Productputative oxidoreductase
Product (GenBank)ketone reductase
Geneorf17
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)
  • ORF20
Reference
ACC
PmId
[18328078] The biosynthetic genes encoding for the production of the dynemicin enediyne core in Micromonospora chersina ATCC53710. (FEMS Microbiol Lett. , 2008)
Family/Domain
FD
IPR013968

close this sectionSequence

selected fasta
>putative oxidoreductase [ketone reductase]
MLQDHDRYIFMKLLSGRCPMSPEPLSRPSRIALRALRPAPAPVRPTPRATRWRVTGPADH
PLVRHLRRQPYPAAGPEADVLVLGGRWPAGGAGVLLDAYQRAAGRQLTLVHDGAGGGSLL
RGLGAGDGRPVGTVALGDPTPAALRRAAGLLAAPSAADELTVAADGTVHTLGWRAAPLPG
RAPRFAGATVLVTGGLGGLGSRLAVALAAAGAVPVLLDVRTPDDAPPDVRRMLTLLRRRC
PRARLLTLDLTDPAAARAALAGLRPTAIVHCAGRIAGGTGVRLGPAEVDALVAAKVATLE
TVLATVRAKRLRAVLTFGSLTAHGAHPGLAGYALANELLHRATARYAATHPGVRCCTAEW
SLWSGAGMARQVARVAARHLGMVPVPVATGVAAATRLLAALVDAPPDEDLPDSLLVCSER
PGTQGAWSGRPEGVPGVDAALVVPAGGDLDMAMRAVAEAAAGGAALIPDGTAGPGAPLLV
RATVTGDGVDCVVRSGADPDGPALRSSRYRLLPAGT
selected fasta
>putative oxidoreductase [ketone reductase]
TTGCTTCAAGACCACGATCGATATATCTTTATGAAGTTGCTGAGTGGAAGGTGCCCCATG
TCACCTGAGCCCCTCTCGCGCCCCTCCCGGATCGCCCTGCGCGCCCTGCGGCCCGCGCCG
GCGCCCGTCCGGCCCACCCCCCGCGCGACCCGCTGGCGGGTGACCGGCCCGGCCGACCAC
CCCCTCGTCCGGCACCTGCGCCGGCAGCCCTATCCGGCCGCCGGACCCGAGGCCGACGTG
CTGGTCCTCGGTGGACGGTGGCCGGCCGGCGGCGCCGGGGTGCTGCTCGACGCGTACCAG
CGGGCCGCCGGGCGGCAGCTCACGCTGGTCCACGACGGAGCCGGCGGCGGCAGCCTGCTG
CGCGGGCTCGGCGCCGGGGACGGCCGGCCGGTCGGCACCGTCGCGCTGGGCGACCCCACC
CCGGCGGCGTTGCGCCGCGCCGCCGGCCTGCTCGCCGCGCCGTCCGCCGCCGACGAGCTC
ACCGTGGCCGCCGACGGCACCGTGCACACCCTCGGCTGGCGGGCCGCCCCGCTGCCCGGC
CGGGCGCCACGCTTCGCCGGGGCCACCGTCCTGGTCACCGGCGGCCTGGGCGGGCTCGGC
AGCCGCCTCGCCGTCGCCCTGGCCGCCGCCGGCGCCGTCCCGGTCCTGCTCGACGTGCGT
ACGCCTGACGACGCCCCGCCCGACGTCCGCCGGATGCTCACCCTGCTGCGGCGGCGCTGC
CCCCGGGCCCGGCTGCTCACCCTCGACCTCACCGACCCGGCGGCCGCCCGCGCGGCCCTG
GCCGGGCTGCGGCCCACCGCGATCGTGCACTGCGCCGGCCGGATCGCCGGCGGCACCGGG
GTACGCCTCGGCCCCGCCGAGGTCGACGCCCTGGTCGCCGCGAAGGTCGCCACCCTGGAG
ACGGTGCTCGCCACGGTCCGCGCGAAGCGGCTGCGGGCGGTGCTCACCTTCGGCTCGCTC
ACCGCGCACGGCGCGCACCCGGGGCTCGCCGGCTACGCCCTCGCGAACGAACTGCTGCAC
CGGGCCACCGCCCGGTACGCCGCCACGCACCCCGGGGTCCGCTGCTGCACCGCCGAGTGG
TCACTCTGGTCCGGCGCCGGGATGGCCCGGCAGGTGGCCCGGGTCGCCGCCCGGCACCTC
GGCATGGTGCCGGTGCCGGTGGCCACCGGTGTCGCCGCGGCCACCCGGCTGCTCGCCGCG
CTTGTCGACGCCCCGCCCGACGAGGACCTGCCCGACTCGCTGCTCGTCTGCAGCGAGCGC
CCCGGCACGCAGGGCGCCTGGTCGGGGCGGCCGGAGGGCGTACCCGGAGTGGACGCCGCC
CTGGTCGTGCCGGCCGGCGGCGACCTCGACATGGCGATGCGCGCGGTGGCCGAGGCGGCG
GCCGGCGGCGCCGCGTTGATCCCGGACGGGACGGCCGGTCCGGGCGCGCCGCTGCTGGTC
CGGGCCACGGTCACCGGTGACGGGGTGGACTGCGTGGTCCGCTCCGGCGCCGACCCCGAC
GGGCCGGCACTGCGCAGCTCCCGCTACCGGCTGCTGCCCGCCGGCACCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR013968 Polyketide synthase, KR (Domain)
 [188-365]  4.9e-21 PF08659
PF08659   KR
IPR016040 NAD(P)-binding domain (Domain)
 [183-402]  8.1e-22 G3DSA:3.40.50.720
G3DSA:3.40.50.720   NAD(P)-bd
SignalP No significant hit
TMHMM No significant hit