close all open/close all

CDS information : Dynm_00320


close this sectionLocation

Organism
StrainATCC 53710 (=NBRC 15963)
Entry nameDynemicin
Contig
Start / Stop / Direction45,570 / 46,421 / + [in whole cluster]
45,570 / 46,421 / + [in contig]
Location45570..46421 [in whole cluster]
45570..46421 [in contig]
TypeCDS
Length852 bp (283 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category4.1 transcriptional regulator
Productputative AraC family transcriptional regulator
Product (GenBank)DynR7
GenedynR7
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)
  • putative transcriptional regulator
Reference
ACC
PmId
[18328078] The biosynthetic genes encoding for the production of the dynemicin enediyne core in Micromonospora chersina ATCC53710. (FEMS Microbiol Lett. , 2008)
Related Reference
ACC
Q8GME4
NITE
C1027_00490
PmId
[19159491] Role of sgcR3 in positive regulation of enediyne antibiotic C-1027 production of Streptomyces globisporus C-1027. (BMC Microbiol. , 2009)
[20551990] Manipulation of pathway regulation in Streptomyces globisporus for overproduction of the enediyne antitumor antibiotic C-1027. (J Antibiot (Tokyo). , 2010)
Family/Domain
FD
IPR018060

close this sectionSequence

selected fasta
>putative AraC family transcriptional regulator [DynR7]
MAHDRAAVRGDRTEPAHRRGRSTVLQQHRDAVSRVVRAMRDRLDEPWTLSRLAQVAYLSP
FHFSRVFRLVTGTPPGRFLSALRMAEARRLVVSSRMNVTDICTTVGYSSLGTFTTQFTEQ
VGVGPGRLRRLDAAHGDRPLEHVVAAGTGPAEEDEPPGGVVTGTVHAPAGDARLVLLGLF
PTPLAQGLPVACTSVTGDGPFAVTGAPEGTWHLLACAHPEAVTVGEVLAGARDPDVWVGV
ADAPVVVRAGRTTGPLAVRLAPARPIDPPILTGLPVLPLAARP
selected fasta
>putative AraC family transcriptional regulator [DynR7]
ATGGCCCACGACCGCGCCGCCGTCCGGGGCGACCGCACCGAGCCGGCGCACCGGCGCGGC
CGGTCGACAGTCCTCCAGCAGCACCGGGATGCGGTCTCCCGGGTCGTCCGGGCCATGCGG
GACCGGCTCGACGAGCCGTGGACCCTGTCCCGGCTGGCCCAGGTGGCGTATCTCAGCCCG
TTCCACTTCAGCCGGGTGTTCCGGCTGGTCACCGGCACCCCGCCGGGGCGGTTCCTGTCC
GCGCTGCGGATGGCCGAGGCGCGCCGGCTGGTGGTCTCCAGCCGGATGAACGTCACCGAC
ATCTGCACCACGGTCGGCTACAGCAGCCTGGGCACCTTCACCACCCAGTTCACCGAGCAG
GTCGGGGTCGGGCCGGGCCGGCTGCGGCGGCTGGACGCCGCGCACGGCGACCGGCCGCTG
GAGCACGTGGTCGCCGCCGGGACCGGGCCGGCGGAGGAGGACGAGCCGCCCGGGGGCGTG
GTCACGGGCACCGTGCACGCCCCGGCCGGGGACGCCCGGCTGGTGCTGCTCGGGCTCTTC
CCCACCCCGCTGGCCCAGGGGCTCCCCGTCGCCTGCACCAGCGTCACGGGCGACGGCCCG
TTCGCCGTCACCGGCGCGCCCGAGGGCACCTGGCACCTGCTGGCCTGCGCCCACCCCGAG
GCGGTCACCGTCGGCGAGGTGCTGGCCGGCGCCCGCGATCCGGACGTGTGGGTCGGGGTG
GCCGACGCGCCGGTGGTGGTCCGTGCGGGCCGCACCACCGGTCCACTGGCCGTGCGGCTG
GCCCCGGCCCGCCCCATCGACCCGCCGATCCTCACCGGCCTGCCGGTGCTCCCCCTCGCC
GCCCGCCCGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR009057 Homeodomain-like (Domain)
 [26-82]  2.2e-19 G3DSA:1.10.10.60 [83-130]  2.9e-16 G3DSA:1.10.10.60
G3DSA:1.10.10.60   Homeodomain-rel
 [28-79]  4.30000170645867e-11 SSF46689 [82-130]  6.49999377884395e-11 SSF46689
SSF46689   Homeodomain_like
IPR018060 DNA binding HTH domain, AraC-type (Domain)
 [33-131]  PS01124
PS01124   HTH_ARAC_FAMILY_2
 [46-129]  2.70000183580794e-28 SM00342
SM00342   HTH_ARAC
SignalP No significant hit
TMHMM No significant hit