close all open/close all

CDS information : Dynm_00330


close this sectionLocation

Organism
StrainATCC 53710 (=NBRC 15963)
Entry nameDynemicin
Contig
Start / Stop / Direction47,724 / 46,468 / - [in whole cluster]
47,724 / 46,468 / - [in contig]
Locationcomplement(46468..47724) [in whole cluster]
complement(46468..47724) [in contig]
TypeCDS
Length1,257 bp (418 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.1 general function
Productputative protein kinase
Product (GenBank)hypothetical protein
Geneorf18
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)
  • ORF22; COG0661.2; predicted protein kinase; CalR3-like protein
Reference
ACC
PmId
[18328078] The biosynthetic genes encoding for the production of the dynemicin enediyne core in Micromonospora chersina ATCC53710. (FEMS Microbiol Lett. , 2008)
Family/Domain
FD
IPR000719

close this sectionSequence

selected fasta
>putative protein kinase [hypothetical protein]
MSLRMFLRVLAIVAVASGEALRTLPASLVLRVTRGPEAAADRRYRGMVRALQRLGPTFVK
FGQIAGTRRDALPPALCARLGTLFDEVPPMSAAAAGEALRRARAEQPRLVLRSVDPEPLA
SGSIASVYRAVLDDGTVVALKLKRPGIDDRMRADLRLVELMARLAARAPKMRGMPIADLV
GYLSAAILGQLDFHREAANSERLRGELAELPEVRVPLLHRDRSASNCLVFEYLPDLDGRT
VERLDPRVRAHLAEVVLAAVHRLFFGAGFVHCDLHPGNLYLTRDERVVVLDAGYCVQLPD
GVRAAIGEFFARLGAGDGRRCGEIVLASAVNAGAGLDREGFVRDVAELVARTAGPDNEFD
MSVFGNGVYDLQQRYGIYAASDFAFPLMSLLVVEGTVRGISPDVDFQRVGGPAPTPHA
selected fasta
>putative protein kinase [hypothetical protein]
ATGTCGCTGCGGATGTTCCTGCGGGTGCTGGCCATCGTCGCCGTGGCGTCCGGTGAGGCG
CTGCGGACCCTTCCGGCGTCCCTCGTACTGCGGGTGACCCGGGGGCCGGAGGCGGCGGCC
GACCGCCGCTACCGGGGGATGGTGCGGGCGCTGCAACGGCTGGGCCCGACCTTCGTGAAG
TTCGGCCAGATCGCCGGCACCCGCCGGGACGCCCTCCCGCCCGCGCTCTGCGCCCGGCTC
GGCACCCTCTTCGACGAGGTGCCGCCGATGTCCGCCGCGGCGGCCGGCGAGGCGCTGCGC
CGCGCCCGGGCGGAACAGCCCCGGCTGGTGCTGCGCTCGGTGGACCCCGAGCCGCTGGCC
AGCGGCAGCATCGCCTCGGTCTACCGGGCCGTGCTGGACGACGGCACCGTGGTGGCGCTG
AAGCTCAAGCGGCCCGGCATCGACGACCGGATGCGGGCGGACCTGCGGCTCGTCGAGCTG
ATGGCGCGGCTGGCCGCACGGGCGCCGAAGATGCGGGGCATGCCCATCGCCGACCTGGTC
GGCTATCTCAGCGCGGCGATCCTCGGCCAGCTCGACTTCCACCGGGAGGCGGCGAACAGC
GAACGGCTCCGCGGCGAGCTGGCCGAGCTGCCGGAGGTCAGGGTGCCACTGCTGCACCGG
GACCGGTCGGCGTCGAACTGCCTGGTCTTCGAGTACCTGCCGGATCTGGACGGGCGGACG
GTCGAGCGGCTCGACCCGCGGGTCCGGGCGCACCTCGCCGAGGTGGTGCTGGCCGCCGTG
CACCGGCTCTTCTTCGGTGCCGGCTTCGTCCACTGCGACCTGCACCCGGGCAACCTCTAC
CTGACCCGGGACGAGCGGGTGGTGGTCCTCGATGCCGGCTACTGCGTCCAGCTGCCCGAC
GGCGTACGGGCGGCGATCGGTGAGTTCTTCGCCCGGCTGGGAGCGGGGGACGGCCGGCGG
TGCGGCGAGATCGTGCTGGCCAGCGCGGTGAACGCCGGCGCCGGCCTGGACCGGGAGGGC
TTCGTCCGGGACGTGGCGGAGCTGGTGGCCCGGACCGCCGGCCCGGACAACGAGTTCGAC
ATGTCGGTCTTCGGCAACGGCGTGTACGACCTCCAGCAGCGGTACGGCATCTACGCCGCC
TCCGACTTCGCCTTCCCGCTCATGTCCCTGCTGGTGGTCGAGGGCACGGTGCGCGGGATC
AGCCCCGACGTCGACTTCCAGCGGGTCGGTGGACCGGCGCCCACCCCGCACGCGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000719 Protein kinase, catalytic domain (Domain)
 [113-418]  PS50011
PS50011   PROTEIN_KINASE_DOM
IPR004147 UbiB domain (Domain)
 [107-217]  7.59999999999998e-27 PF03109
PF03109   ABC1
IPR011009 Protein kinase-like domain (Domain)
 [112-302]  1e-18 SSF56112
SSF56112   Kinase_like
SignalP
 [1-18]  0.71 Signal
Eukaryota   
TMHMM No significant hit