close all open/close all

CDS information : Dynm_00340


close this sectionLocation

Organism
StrainATCC 53710 (=NBRC 15963)
Entry nameDynemicin
Contig
Start / Stop / Direction48,871 / 47,735 / - [in whole cluster]
48,871 / 47,735 / - [in contig]
Locationcomplement(47735..48871) [in whole cluster]
complement(47735..48871) [in contig]
TypeCDS
Length1,137 bp (378 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.1 general function
Productputative oxidoreductase
Product (GenBank)FAD-dependent oxidoreductase
GenedynE13
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)
  • ORF23
Reference
ACC
PmId
[18328078] The biosynthetic genes encoding for the production of the dynemicin enediyne core in Micromonospora chersina ATCC53710. (FEMS Microbiol Lett. , 2008)
Related Reference
ACC
B6D1N4
PmId
[18849434] The hpx genetic system for hypoxanthine assimilation as a nitrogen source in Klebsiella pneumoniae: gene organization and transcriptional regulation. (J Bacteriol. , 2008)
Family/Domain
FD
IPR002938

close this sectionSequence

selected fasta
>putative oxidoreductase [FAD-dependent oxidoreductase]
MTTRRALVVGGGPAGLATALALRDAGWDALVLERSADEGPSGVALTLWPNALSALAAVGA
DKPVRAAGCPADGNQIRAADGRILDDVPGRLMAERFGGRGLALLRADLVEALRAQLSPGM
LRTGARCVGWTEYGGRVRVTLADGGTEVGDLLVGADGLRSTIRRQLLGGGADPLRYAGYP
VWRGIARYDLGAAPGLLTMGRAAQFGLFPLPEGRAYWFATMPLRRGWGEQLPRRVWAARF
DGWHAPIPQVLAATPDEDVLVTDIYDRAPVPRWSAGRVVLVGDAAHPSTPNLGQGTCQAL
EDAVVLGRCLRDDDVAEALPRYEAARRRRADGLTRQARMLGRVGQWSNPVACWIREQMIR
RAPAGPRLRQMAEMFAFE
selected fasta
>putative oxidoreductase [FAD-dependent oxidoreductase]
ATGACGACTCGACGGGCGCTCGTCGTCGGCGGCGGGCCGGCCGGGCTGGCGACCGCGCTG
GCCCTGCGGGACGCGGGCTGGGACGCGCTGGTCCTCGAACGCAGCGCGGACGAGGGGCCC
TCCGGCGTCGCCCTCACCCTCTGGCCGAACGCCCTGTCGGCACTCGCCGCCGTCGGTGCC
GACAAGCCGGTACGGGCGGCCGGCTGCCCGGCCGACGGCAACCAGATCCGCGCCGCCGAC
GGGCGGATCCTCGACGACGTGCCGGGGCGGTTGATGGCGGAGCGCTTCGGCGGCCGGGGC
CTGGCGCTGCTCCGTGCCGACCTGGTCGAGGCGCTGCGCGCCCAACTCTCCCCGGGGATG
CTGCGCACCGGCGCCCGCTGCGTGGGCTGGACGGAGTACGGCGGCCGGGTACGCGTCACC
CTCGCCGACGGCGGCACCGAGGTGGGCGACCTCCTCGTCGGCGCGGACGGACTGCGCTCG
ACGATCCGCCGCCAGTTGCTCGGCGGCGGCGCGGACCCGCTGCGCTACGCGGGTTACCCG
GTCTGGCGCGGCATCGCCCGGTACGACCTCGGCGCCGCGCCGGGCCTGCTCACCATGGGC
CGGGCCGCCCAGTTCGGGCTGTTCCCGCTGCCCGAGGGGCGGGCGTACTGGTTCGCCACC
ATGCCGCTGCGCCGGGGCTGGGGTGAGCAGTTGCCCCGCCGGGTCTGGGCGGCCCGGTTC
GACGGCTGGCACGCGCCCATCCCGCAGGTGCTGGCCGCCACCCCGGACGAGGACGTCCTG
GTCACCGACATCTACGACCGCGCGCCCGTGCCCCGGTGGAGCGCCGGGCGGGTGGTCCTG
GTCGGCGACGCCGCGCACCCCAGCACCCCGAACCTGGGCCAGGGCACCTGCCAGGCGCTG
GAGGACGCCGTCGTGCTGGGCCGCTGCCTGCGCGACGACGACGTGGCCGAGGCCCTGCCC
CGGTACGAGGCGGCGCGCCGCCGTCGGGCGGACGGCCTCACCCGCCAGGCCCGGATGCTC
GGCCGGGTCGGGCAGTGGAGCAACCCGGTGGCCTGCTGGATCCGGGAGCAGATGATCCGC
CGCGCCCCGGCCGGTCCGCGGCTGCGGCAGATGGCGGAGATGTTCGCCTTCGAGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR002938 Monooxygenase, FAD-binding (Domain)
 [6-336]  2.2e-22 PF01494
PF01494   FAD_binding_3
IPR003042 Aromatic-ring hydroxylase-like (Domain)
 [5-27]  6.79998707392904e-20 PR00420 [148-163]  6.79998707392904e-20 PR00420 [275-290]  6.79998707392904e-20 PR00420 [290-306]  6.79998707392904e-20 PR00420
PR00420   RNGMNOXGNASE
SignalP No significant hit
TMHMM No significant hit