close all open/close all

CDS information : Dynm_00360


close this sectionLocation

Organism
StrainATCC 53710 (=NBRC 15963)
Entry nameDynemicin
Contig
Start / Stop / Direction49,551 / 50,054 / + [in whole cluster]
49,551 / 50,054 / + [in contig]
Location49551..50054 [in whole cluster]
49551..50054 [in contig]
TypeCDS
Length504 bp (167 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.1 modification hydroxylation
Productputative hydroxylase
Product (GenBank)putative hydroxylase
GenedynA2
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)
  • ORF25
Reference
ACC
PmId
[18328078] The biosynthetic genes encoding for the production of the dynemicin enediyne core in Micromonospora chersina ATCC53710. (FEMS Microbiol Lett. , 2008)
Related Reference
ACC
Q9RN64
NITE
Nogl_00150
PmId
[16650858] Crystal structures of SnoaL2 and AclR: two putative hydroxylases in the biosynthesis of aromatic polyketide antibiotics. (J Mol Biol. , 2006)
[11683270] The entire nogalamycin biosynthetic gene cluster of Streptomyces nogalater: characterization of a 20-kb DNA region and generation of hybrid structures. (Mol Genet Genomics. , 2001)
[22633406] SnoaW/SnoaL2: a different two-component monooxygenase. (Chem Biol. , 2012)
[22633415] Discovery of a two-component monooxygenase SnoaW/SnoaL2 involved in nogalamycin biosynthesis. (Chem Biol. , 2012)

close this sectionSequence

selected fasta
>putative hydroxylase [putative hydroxylase]
MTGHHPDLAQRKREFEETVRNFRKAVLFDYDLTAVQHVLAPGFVDHFAPPWDPPSRDGVA
HRFDHANQVLTTRKVEVLVSVCEGDILAQAILLHFEHTGPFMGIPATGRRFEIGGSNTFR
FENGRIAEHWGVFDVAKIPDLLAGEPGAAGGWSSMWDREEIGTAGKG
selected fasta
>putative hydroxylase [putative hydroxylase]
ATGACCGGACACCACCCGGATCTGGCGCAGCGCAAACGCGAGTTCGAGGAGACCGTGCGG
AATTTCCGCAAGGCGGTGCTGTTCGACTACGACCTCACGGCCGTGCAGCACGTCCTCGCG
CCGGGCTTCGTCGACCATTTCGCCCCGCCGTGGGACCCGCCGAGCCGCGACGGCGTGGCG
CACCGGTTCGACCACGCGAACCAGGTGCTCACCACCCGCAAGGTCGAGGTGCTCGTGTCG
GTGTGCGAGGGCGACATCCTGGCCCAGGCCATCCTGCTGCACTTCGAGCACACCGGGCCG
TTCATGGGCATCCCGGCGACCGGCCGCCGGTTCGAGATCGGCGGCTCCAACACGTTCCGG
TTCGAGAACGGCAGGATCGCCGAGCACTGGGGCGTCTTCGACGTCGCGAAGATCCCCGAC
CTGCTGGCCGGCGAGCCGGGTGCGGCCGGCGGCTGGTCGTCCATGTGGGACCGCGAGGAG
ATCGGCACCGCCGGCAAGGGCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR009959 Polyketide cyclase SnoaL-like domain (Domain)
 [19-129]  1.3e-11 PF12680
PF12680   SnoaL_2
SignalP No significant hit
TMHMM No significant hit