close all open/close all

CDS information : Dynm_00370


close this sectionLocation

Organism
StrainATCC 53710 (=NBRC 15963)
Entry nameDynemicin
Contig
Start / Stop / Direction51,078 / 50,182 / - [in whole cluster]
51,078 / 50,182 / - [in contig]
Locationcomplement(50182..51078) [in whole cluster]
complement(50182..51078) [in contig]
TypeCDS
Length897 bp (298 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.1 general function
Productputative oxidoreductase
Product (GenBank)conserved hypothetical protein
GenedynA3
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)
  • ORF26
Reference
ACC
PmId
[18328078] The biosynthetic genes encoding for the production of the dynemicin enediyne core in Micromonospora chersina ATCC53710. (FEMS Microbiol Lett. , 2008)
Related Reference
ACC
Q8KU07
PmId
[12147495] Molecular cloning and characterization of the gene coding for the aerobic azoreductase from Xenophilus azovorans KF46F. (Appl Environ Microbiol. , 2002)

close this sectionSequence

selected fasta
>putative oxidoreductase [conserved hypothetical protein]
MSGTILVTGATGRVGSELVRLLAGAGVRPRALVRDVERARQKLGDAADLVAGDLNRPADL
DAALAGVERLFVLTATSRGQLTQERNAIDAAVRAGVRHVVKLSVLDAGRESPLRHGVWQG
DANALLVNSAVDHTVLQLAFFMQNLFGMVAGGAIRSSAGDGRVAMVDARDVAAAATAVLT
DCPDWARNETLVLSGPEALSFDDTAKVLAEATGVPVRHLPVPREQVAAMLRQFGAEEWYA
EDVAVFNDLIAAGRVQAVTDTVRRLTGAEPRSLGDFAREFAAVFQRAAAPPPGGWRAG
selected fasta
>putative oxidoreductase [conserved hypothetical protein]
ATGAGCGGGACGATCCTGGTCACCGGCGCCACCGGCCGGGTCGGGTCGGAGCTGGTCCGG
CTGCTCGCCGGAGCCGGCGTCCGGCCCCGGGCCCTGGTCCGCGACGTCGAGCGGGCCCGG
CAGAAGCTCGGGGACGCCGCGGACCTGGTCGCCGGTGACCTGAACCGGCCGGCGGACCTG
GACGCCGCGCTGGCCGGGGTGGAGCGGCTGTTCGTGCTCACGGCGACCAGCCGGGGGCAG
CTCACCCAGGAGCGCAACGCGATCGACGCGGCGGTACGCGCCGGCGTGCGGCACGTGGTG
AAGCTGTCGGTGCTGGACGCCGGACGCGAGTCGCCGCTGCGGCACGGCGTCTGGCAGGGC
GACGCGAACGCGCTGCTGGTCAACTCCGCGGTCGACCACACCGTGCTGCAACTGGCGTTC
TTCATGCAGAACCTGTTCGGGATGGTGGCCGGGGGCGCGATCCGCAGCTCGGCCGGTGAC
GGCCGGGTGGCGATGGTCGACGCGCGGGACGTGGCGGCCGCCGCGACGGCGGTGCTCACC
GACTGCCCCGACTGGGCGCGCAACGAGACACTGGTGCTGTCCGGCCCGGAGGCGCTCTCC
TTCGACGACACGGCGAAGGTGCTGGCCGAGGCCACCGGTGTCCCGGTGCGCCACCTTCCG
GTGCCGCGTGAGCAGGTGGCCGCCATGCTGCGGCAGTTCGGCGCCGAGGAGTGGTACGCC
GAGGACGTGGCGGTGTTCAACGACCTGATCGCCGCCGGCCGGGTCCAGGCGGTCACCGAC
ACCGTGCGGCGGCTGACCGGCGCCGAGCCCCGGTCGCTGGGCGACTTCGCCCGGGAGTTC
GCGGCCGTCTTCCAGCGGGCGGCCGCACCGCCGCCGGGCGGGTGGCGGGCTGGCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR016040 NAD(P)-binding domain (Domain)
 [1-207]  3.40000000000004e-42 G3DSA:3.40.50.720
G3DSA:3.40.50.720   NAD(P)-bd
SignalP No significant hit
TMHMM No significant hit