close all open/close all

CDS information : Dynm_00380


close this sectionLocation

Organism
StrainATCC 53710 (=NBRC 15963)
Entry nameDynemicin
Contig
Start / Stop / Direction52,604 / 51,075 / - [in whole cluster]
52,604 / 51,075 / - [in contig]
Locationcomplement(51075..52604) [in whole cluster]
complement(51075..52604) [in contig]
TypeCDS
Length1,530 bp (509 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.1 general function
Productputative tripeptidylaminopeptidase
Product (GenBank)putative secreted hydrolase
GenedynA4
Gene (GenBank)
EC number
Keyword
Note
  • Contains one Alpha/beta hydrolase fold-1 domain (IPR000073).
Note (GenBank)
  • ORF27
Reference
ACC
PmId
[18328078] The biosynthetic genes encoding for the production of the dynemicin enediyne core in Micromonospora chersina ATCC53710. (FEMS Microbiol Lett. , 2008)
Related Reference
ACC
Q54410
PmId
[7487044] Cloning and characterization of a gene encoding a secreted tripeptidyl aminopeptidase from Streptomyces lividans 66. (Appl Environ Microbiol. , 1995)

close this sectionSequence

selected fasta
>putative tripeptidylaminopeptidase [putative secreted hydrolase]
MRGGRLHDRREADGAQPVQHPLRAPGLKGERHMSVDVHSSDLARFHRQRLTWQPTEGGAG
TETSRVTVPLDYRDPAGRTIEIAVARRPAGDPGQRIGVLMIAPDDPGNRGIPLIGQLVGA
LPAEVLDRFDLVAFDHRFSGDSHPIEVDWTPEERLWVFHRPQSITEEIRFQSKVAAKVAD
VALDLLPHASTRNVARDMDVVRAALGEERISYLGWSYGTYLGAVYTQLFGERADRVVLDS
VLSPDWPWRGLFLNVAASTEAAVNRWCGWAAARDGELRLGDSAAAVRSRYDELLERAGRE
PLAVPGLPMPLDRFALEFFTVVMLTADRTYPLLGAVLRAAVHGDPVPGPAVGELMGLVNQ
RQDSTPAGQLAILCGESSWPRDLDRYEAEMASVGAELPFIGRTLASVKAGAFWPTSPVEP
LTEIGPGNSARSILLVQSEADIFTRAVGAWRLRELLPENSRLVLAADTACHKLFPFGGHP
VVNELTTRYLLTGELPEKDVTVENHQESA
selected fasta
>putative tripeptidylaminopeptidase [putative secreted hydrolase]
GTGCGAGGAGGCCGGCTTCACGACCGTCGAGAAGCTGATGGAGCCCAGCCCGTTCAACAC
CCTCTACGAGCTCCGGGCCTGAAGGGAGAACGTCACATGTCCGTCGATGTTCACAGCAGC
GACCTGGCCCGCTTCCACCGGCAGCGCCTGACCTGGCAGCCGACCGAGGGCGGGGCGGGT
ACGGAGACCAGCCGCGTCACCGTCCCGCTCGACTACCGCGACCCCGCCGGGCGCACCATC
GAGATCGCCGTGGCCCGCCGGCCCGCCGGCGATCCCGGGCAGCGGATCGGGGTGCTGATG
ATCGCGCCCGACGACCCGGGCAACCGGGGCATCCCGCTGATCGGGCAGCTCGTCGGGGCG
CTTCCGGCCGAGGTGCTGGACCGGTTCGACCTGGTCGCCTTCGACCACCGGTTCAGCGGC
GACAGCCACCCCATCGAGGTGGACTGGACGCCCGAGGAGCGGCTCTGGGTCTTCCACCGG
CCCCAGAGCATCACCGAGGAGATCCGGTTCCAGTCCAAGGTGGCCGCCAAGGTCGCCGAC
GTCGCGCTGGACCTGCTGCCGCACGCCAGCACCCGCAACGTGGCCCGGGACATGGACGTC
GTCCGGGCCGCGCTCGGCGAGGAGAGGATCTCCTACCTCGGCTGGTCGTACGGGACCTAC
CTGGGCGCGGTCTACACCCAGCTGTTCGGCGAGCGGGCCGACCGGGTGGTGCTGGACAGC
GTGCTCAGCCCGGACTGGCCCTGGCGCGGGCTCTTCCTCAACGTCGCGGCCAGCACCGAG
GCGGCGGTGAACCGCTGGTGCGGCTGGGCCGCGGCGCGCGACGGCGAGCTGCGCCTGGGC
GACAGCGCGGCGGCGGTCCGGTCCCGCTACGACGAGCTGCTGGAGCGGGCCGGCCGGGAG
CCGCTGGCCGTGCCCGGGCTGCCCATGCCGCTGGACCGGTTCGCGCTGGAGTTCTTCACC
GTGGTGATGCTGACCGCGGACCGCACGTACCCGCTGCTCGGCGCGGTGCTGAGGGCCGCG
GTGCACGGCGACCCGGTGCCCGGCCCGGCGGTCGGCGAGCTGATGGGACTTGTCAACCAG
CGCCAGGACAGCACCCCGGCCGGGCAGCTCGCCATCCTCTGCGGCGAGTCGAGCTGGCCG
CGCGACCTCGACCGGTACGAGGCCGAGATGGCGAGTGTGGGCGCGGAGCTGCCGTTCATC
GGGCGCACCCTGGCCTCGGTGAAGGCCGGCGCGTTCTGGCCGACCTCGCCCGTGGAGCCG
CTGACCGAGATCGGGCCGGGGAACAGCGCCCGGTCGATCCTGCTCGTGCAGTCCGAGGCG
GACATCTTCACCCGGGCGGTCGGGGCGTGGCGGCTGCGCGAGCTGCTGCCGGAGAACAGC
CGGCTCGTGCTCGCCGCCGACACGGCGTGCCACAAGCTCTTCCCGTTCGGGGGGCACCCG
GTGGTCAACGAGCTGACCACCCGGTACCTGCTGACCGGCGAGCTGCCGGAGAAGGACGTG
ACCGTCGAGAACCACCAGGAGTCGGCATGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000073 Alpha/beta hydrolase fold-1 (Domain)
 [129-242]  2.9e-14 PF00561
PF00561   Abhydrolase_1
IPR013595 Peptidase S33 tripeptidyl aminopeptidase-like, C-terminal (Domain)
 [398-501]  3.60000000000001e-12 PF08386
PF08386   Abhydrolase_4
SignalP No significant hit
TMHMM No significant hit