close all open/close all

CDS information : Dynm_00400


close this sectionLocation

Organism
StrainATCC 53710 (=NBRC 15963)
Entry nameDynemicin
Contig
Start / Stop / Direction54,902 / 53,691 / - [in whole cluster]
54,902 / 53,691 / - [in contig]
Locationcomplement(53691..54902) [in whole cluster]
complement(53691..54902) [in contig]
TypeCDS
Length1,212 bp (403 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.3 modification reduction
Productputative cytochrome P450
Product (GenBank)putative cytochrome P450 hydroxylase
Geneorf19
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)
  • ORF29; CalE10-like protein
Reference
ACC
PmId
[18328078] The biosynthetic genes encoding for the production of the dynemicin enediyne core in Micromonospora chersina ATCC53710. (FEMS Microbiol Lett. , 2008)
Related Reference
ACC
Q59523
PmId
[7808395] Characterization and expression of a P-450-like mycinamicin biosynthesis gene using a novel Micromonospora-Escherichia coli shuttle cosmid vector. (Mol Gen Genet. , 1994)
ACC
Q9KHJ7
NITE
Enter_00180
PmId
[11137817] Cloning, sequencing and analysis of the enterocin biosynthesis gene cluster from the marine isolate 'Streptomyces maritimus': evidence for the derailment of an aromatic polyketide synthase. (Chem Biol. , 2000)
[17704772] Enzymatic total synthesis of enterocin polyketides. (Nat Chem Biol. , 2007)

close this sectionSequence

selected fasta
>putative cytochrome P450 [putative cytochrome P450 hydroxylase]
MSTQSDATGTRHATFPFPQDDPCLPPPEYARLRADEPVTQVVLPTGDRAWLVTRHADVLT
VLGDERFSRRALTGPDAPKLAPIPPMPSLFYLDPPDHTRIRRLAARAFDPARLARLRPRV
DRVVAAHLDRLAAADQPADLLATVARPLPLAVVATVLGVPEDEYEPFAGWIRTAFSFGAV
PPDEQMAAMGGLQQYLAALVGSRRKEPAEDALSDLVAPTGDDQLADHELVALVFDLIGAG
DQPVTAEIVHLVLNLLRDPARLPALHAEPELVPGAVEELLRHSQSAGGGLGSVRIAVADV
ELSGVTIPAGDPVIPSFNAANFDESVFPDADRIDLARRPNPHLTFAQGIHHCLGAPVGRM
ELTALLGGLARDFPSLRLAVPEDQLQWLPVPAFRTPGAIPVHW
selected fasta
>putative cytochrome P450 [putative cytochrome P450 hydroxylase]
ATGAGCACCCAGTCCGACGCGACCGGCACGCGCCACGCCACCTTCCCGTTCCCCCAGGAC
GACCCCTGCCTGCCGCCGCCGGAGTACGCCCGGCTCCGGGCCGACGAGCCGGTCACCCAG
GTGGTCCTGCCCACCGGTGACCGGGCCTGGCTGGTCACCCGGCACGCCGACGTGCTCACC
GTGCTCGGCGACGAGCGGTTCAGCCGCCGGGCACTGACCGGCCCGGACGCGCCGAAACTG
GCCCCGATCCCACCGATGCCGTCGCTGTTCTACCTCGATCCGCCGGACCACACCCGGATC
CGCCGGCTGGCCGCCCGGGCCTTCGACCCGGCCCGGCTGGCCCGGCTGCGGCCCCGGGTC
GACCGGGTCGTCGCCGCCCACCTGGACCGGCTGGCGGCCGCCGACCAGCCGGCCGACCTG
CTCGCCACGGTGGCCCGGCCGCTGCCGCTCGCGGTGGTCGCCACGGTGCTCGGCGTGCCC
GAGGACGAGTACGAGCCGTTCGCCGGCTGGATCCGCACCGCCTTCAGCTTCGGCGCCGTC
CCGCCCGACGAGCAGATGGCGGCCATGGGCGGCCTCCAGCAGTACCTGGCGGCGCTCGTC
GGCAGCCGGCGCAAGGAACCGGCCGAGGACGCGCTCAGCGACCTGGTGGCCCCGACCGGC
GACGACCAGCTCGCCGACCACGAGCTGGTGGCGCTGGTCTTCGACCTGATCGGCGCGGGC
GACCAGCCGGTCACCGCGGAGATCGTGCACCTGGTGCTCAACCTGCTGCGCGATCCCGCC
CGGCTGCCGGCCCTCCACGCCGAGCCGGAGCTGGTGCCGGGCGCCGTCGAGGAACTGCTC
CGGCACTCCCAGTCCGCCGGCGGCGGCCTCGGCTCGGTGCGGATCGCCGTGGCCGACGTG
GAGCTGTCCGGCGTCACCATCCCGGCCGGCGACCCGGTGATCCCCTCCTTCAACGCCGCC
AACTTCGACGAGTCGGTCTTCCCGGACGCGGACCGGATCGACCTGGCGCGGCGGCCCAAC
CCGCACCTGACCTTCGCCCAGGGCATCCACCACTGCCTCGGCGCCCCGGTCGGCCGGATG
GAGCTGACCGCGCTGCTCGGCGGCCTGGCCCGGGACTTCCCGAGCCTGCGGCTGGCGGTG
CCCGAGGACCAGCTCCAGTGGCTGCCGGTGCCCGCGTTCCGGACCCCGGGCGCGATCCCC
GTGCACTGGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001128 Cytochrome P450 (Family)
 [17-403]  3.60000000000002e-93 G3DSA:1.10.630.10
G3DSA:1.10.630.10   Cyt_P450
 [210-373]  1.1e-11 PF00067
PF00067   p450
 [11-403]  3.19999899046355e-81 SSF48264
SSF48264   Cytochrome_P450
IPR002397 Cytochrome P450, B-class (Family)
 [92-103]  1.70000295590053e-50 PR00359 [139-155]  1.70000295590053e-50 PR00359 [156-171]  1.70000295590053e-50 PR00359 [194-216]  1.70000295590053e-50 PR00359 [274-285]  1.70000295590053e-50 PR00359 [294-321]  1.70000295590053e-50 PR00359 [322-337]  1.70000295590053e-50 PR00359 [343-352]  1.70000295590053e-50 PR00359 [352-363]  1.70000295590053e-50 PR00359
PR00359   BP450
SignalP No significant hit
TMHMM No significant hit