close all open/close all

CDS information : Dynm_00410


close this sectionLocation

Organism
StrainATCC 53710 (=NBRC 15963)
Entry nameDynemicin
Contig
Start / Stop / Direction56,147 / 54,945 / - [in whole cluster]
56,147 / 54,945 / - [in contig]
Locationcomplement(54945..56147) [in whole cluster]
complement(54945..56147) [in contig]
TypeCDS
Length1,203 bp (400 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.3 modification reduction
Productputative cytochrome P450
Product (GenBank)putative cytochrome P450 hydroxylase
GenedynE10
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)
  • ORF30
Reference
ACC
PmId
[18328078] The biosynthetic genes encoding for the production of the dynemicin enediyne core in Micromonospora chersina ATCC53710. (FEMS Microbiol Lett. , 2008)
Related Reference
ACC
Q59523
PmId
[7808395] Characterization and expression of a P-450-like mycinamicin biosynthesis gene using a novel Micromonospora-Escherichia coli shuttle cosmid vector. (Mol Gen Genet. , 1994)
ACC
Q54302
NITE
Rapam_00170
PmId
[11372782] Deletion of rapQONML from the rapamycin gene cluster of Streptomyces hygroscopicus gives production of the 16-O-desmethyl-27-desmethoxy analog. (J Antibiot (Tokyo). , 2001)
[16990929] Rapamycin biosynthesis: Elucidation of gene product function. (Org Biomol Chem. , 2006)

close this sectionSequence

selected fasta
>putative cytochrome P450 [putative cytochrome P450 hydroxylase]
MSSDDPAPAYPFTRDVGLTIDKRYRQLLHERPVSRVTLPYGGEAWLVLDHAANRTVLADR
RFSRAKILGADLPRMFPQPMTQVSLLSMDPPDHTRIRRLVAKPFSQRRVEQLRPEIGRHV
DLLLDDVERAGAPADLMSLVAARLPLRVICLILGVPEEDRAQFDAWSETAMSIFTRTREE
TAEALGHLSRYIAGLVAQRRVRPTDDLLSELVAARDGTDRLSEDELVFLGVTLLVVGHET
AEKQVGNLVYTLLTHPDELAGLRKRPDAVPAAVEELLRYIPVQTAHGVFPRVATEDVRLG
DVLIRAGETVFPFSSVANHDPRAFDHPDELDFDRESNLHLAFGHGIHACLGSQLARLELQ
ELVRRLLDRFPELALAVPEAELAWSTEGFVRGLRALPVTW
selected fasta
>putative cytochrome P450 [putative cytochrome P450 hydroxylase]
GTGAGTAGTGACGATCCGGCCCCCGCGTACCCGTTCACCCGGGACGTCGGCCTGACCATC
GACAAGCGGTACCGGCAGCTCCTGCACGAGCGGCCGGTCTCCCGGGTGACCCTCCCGTAC
GGCGGCGAGGCCTGGCTGGTGCTGGACCACGCGGCGAACCGGACCGTGCTGGCCGACCGC
CGGTTCAGCCGGGCGAAGATCCTCGGCGCCGACCTGCCCCGGATGTTCCCCCAGCCGATG
ACGCAGGTGTCCCTGCTCAGCATGGACCCGCCCGACCACACCCGGATCCGCCGCCTGGTG
GCGAAGCCGTTCTCCCAGCGCCGGGTCGAGCAGCTACGGCCGGAGATCGGCCGGCACGTC
GACCTGCTGCTCGACGACGTCGAGCGGGCCGGCGCCCCGGCGGACCTGATGTCGCTGGTC
GCCGCCCGGCTGCCGCTGCGGGTGATCTGCCTGATCCTGGGCGTCCCCGAGGAGGACCGG
GCGCAGTTCGACGCCTGGTCCGAGACCGCCATGTCGATCTTCACCCGGACCCGGGAGGAG
ACCGCCGAGGCGCTCGGCCACCTCTCCCGCTACATCGCCGGGCTGGTCGCGCAGCGCCGC
GTACGCCCCACCGACGACCTGCTCAGCGAGCTGGTGGCGGCCCGGGACGGCACCGACCGG
CTCAGCGAGGACGAGCTGGTCTTCCTCGGGGTGACCCTGCTGGTGGTCGGGCACGAGACC
GCGGAGAAGCAGGTCGGCAACCTGGTCTACACGCTGCTGACCCATCCCGACGAGCTGGCC
GGGCTGCGCAAGCGCCCGGACGCGGTGCCCGCCGCGGTGGAGGAACTGCTCCGCTACATC
CCGGTGCAGACCGCGCACGGCGTCTTCCCCCGGGTCGCCACCGAGGACGTGCGGCTCGGT
GACGTGCTGATCCGGGCCGGGGAGACGGTCTTCCCGTTCTCCTCGGTCGCCAACCACGAC
CCCCGGGCCTTCGACCACCCCGACGAGCTGGACTTCGACCGGGAGTCGAACCTGCACCTC
GCCTTCGGCCACGGCATCCACGCCTGTCTCGGCTCGCAGCTCGCCCGGCTCGAACTCCAG
GAGCTGGTCCGGCGACTGCTCGACCGCTTCCCGGAGCTGGCGCTGGCCGTCCCCGAGGCC
GAGCTGGCCTGGAGCACGGAGGGATTCGTCCGAGGTCTGCGGGCGCTGCCGGTCACCTGG
TGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001128 Cytochrome P450 (Family)
 [11-400]  1.29999999999998e-105 G3DSA:1.10.630.10
G3DSA:1.10.630.10   Cyt_P450
 [236-253]  9.49999985106438e-06 PR00385 [271-282]  9.49999985106438e-06 PR00385 [340-349]  9.49999985106438e-06 PR00385 [349-360]  9.49999985106438e-06 PR00385
PR00385   P450
 [173-370]  7.90000000000001e-18 PF00067
PF00067   p450
 [3-400]  1.09999184471405e-94 SSF48264
SSF48264   Cytochrome_P450
IPR002397 Cytochrome P450, B-class (Family)
 [88-99]  2.50000909916183e-56 PR00359 [135-151]  2.50000909916183e-56 PR00359 [152-167]  2.50000909916183e-56 PR00359 [190-212]  2.50000909916183e-56 PR00359 [271-282]  2.50000909916183e-56 PR00359 [291-318]  2.50000909916183e-56 PR00359 [319-334]  2.50000909916183e-56 PR00359 [340-349]  2.50000909916183e-56 PR00359 [349-360]  2.50000909916183e-56 PR00359
PR00359   BP450
IPR017972 Cytochrome P450, conserved site (Conserved_site)
 [342-351]  PS00086
PS00086   CYTOCHROME_P450
SignalP No significant hit
TMHMM No significant hit