close all open/close all

CDS information : Dynm_00430


close this sectionLocation

Organism
StrainATCC 53710 (=NBRC 15963)
Entry nameDynemicin
Contig
Start / Stop / Direction57,064 / 56,720 / - [in whole cluster]
57,064 / 56,720 / - [in contig]
Locationcomplement(56720..57064) [in whole cluster]
complement(56720..57064) [in contig]
TypeCDS
Length345 bp (114 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category4.1 transcriptional regulator
Productputative ArsR family transcriptional regulator
Product (GenBank)putative transcriptional regulator
GenedynR8
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)
  • ORF32; ArsR family
Reference
ACC
PmId
[18328078] The biosynthetic genes encoding for the production of the dynemicin enediyne core in Micromonospora chersina ATCC53710. (FEMS Microbiol Lett. , 2008)
Related Reference
ACC
Q6PPB8
PmId
[17825068] Characterization of the sgtR1 and sgtR2 genes and their role in regulating expression of the sprT gene encoding Streptomyces griseus trypsin. (FEMS Microbiol Lett. , 2007)
Family/Domain
FD
IPR001845

close this sectionSequence

selected fasta
>putative ArsR family transcriptional regulator [putative transcriptional regulator]
MSPATGVDVFAALASPVRRDLIRLLRDGGPQSVQDLAASFDMRRPSVSEHLKVLRDAGLV
TERRSGRKRLYRLEPEPLMDLRDWLTPYERFWRERMSDFAALVAEESATEGKPV
selected fasta
>putative ArsR family transcriptional regulator [putative transcriptional regulator]
ATGTCCCCCGCCACGGGAGTGGACGTCTTCGCGGCCCTGGCCAGCCCGGTGCGGCGCGAC
CTCATCCGGCTGCTGCGCGACGGCGGCCCGCAGTCGGTGCAGGACCTGGCCGCCTCGTTC
GACATGCGCCGGCCCAGCGTCTCCGAGCACCTCAAGGTGCTCCGCGACGCCGGCCTGGTG
ACCGAGCGCCGCAGCGGCCGGAAGCGGCTCTACCGGCTGGAGCCGGAGCCGCTCATGGAC
CTGCGCGACTGGCTCACCCCCTACGAGCGGTTCTGGCGTGAGCGGATGAGCGACTTCGCC
GCGCTGGTCGCCGAGGAGTCCGCGACCGAGGGGAAGCCGGTGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001845 HTH ArsR-type DNA-binding domain (Domain)
 [8-87]  1.20000117458134e-27 SM00418
SM00418   HTH_ARSR
 [10-25]  2.79999889404114e-12 PR00778 [43-58]  2.79999889404114e-12 PR00778 [58-73]  2.79999889404114e-12 PR00778
PR00778   HTHARSR
 [1-93]  PS50987
PS50987   HTH_ARSR_2
IPR011991 Winged helix-turn-helix transcription repressor DNA-binding (Domain)
 [7-106]  9.40000000000003e-34 G3DSA:1.10.10.10
G3DSA:1.10.10.10   Wing_hlx_DNA_bd
SignalP No significant hit
TMHMM No significant hit