close all open/close all

CDS information : Dynm_00480


close this sectionLocation

Organism
StrainATCC 53710 (=NBRC 15963)
Entry nameDynemicin
Contig
Start / Stop / Direction62,271 / 59,911 / - [in whole cluster]
62,271 / 59,911 / - [in contig]
Locationcomplement(59911..62271) [in whole cluster]
complement(59911..62271) [in contig]
TypeCDS
Length2,361 bp (786 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.1 general function
Productputative oxidoreductase molybdopterin-binding subunit
Product (GenBank)putative carbon monoxide dehydrogenase large subunit
Geneorf21
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)
  • ORF36-1
Reference
ACC
PmId
[18328078] The biosynthetic genes encoding for the production of the dynemicin enediyne core in Micromonospora chersina ATCC53710. (FEMS Microbiol Lett. , 2008)
Related Reference
ACC
P72224
PmId
[8798497] Cloning, expression, and sequence analysis of the three genes encoding quinoline 2-oxidoreductase, a molybdenum-containing hydroxylase from Pseudomonas putida 86. (J Biol Chem. , 1996)
ACC
Q59129
PmId
[7815950] Structural analysis and molybdenum-dependent expression of the pAO1-encoded nicotine dehydrogenase genes of Arthrobacter nicotinovorans. (Mol Microbiol. , 1994)
ACC
P19913
PmId
[10482497] Cloning and molecular characterization of the genes for carbon monoxide dehydrogenase and localization of molybdopterin, flavin adenine dinucleotide, and iron-sulfur centers in the enzyme of Hydrogenophaga pseudoflava. (J Bacteriol. , 1999)
[10966817] The effect of intracellular molybdenum in Hydrogenophaga pseudoflava on the crystallographic structure of the seleno-molybdo-iron-sulfur flavoenzyme carbon monoxide dehydrogenase. (J Mol Biol. , 2000)
[11076018] The role of Se, Mo and Fe in the structure and function of carbon monoxide dehydrogenase. (Biol Chem. , 2000)

close this sectionSequence

selected fasta
>putative oxidoreductase molybdopterin-binding subunit [putative carbon monoxide dehydrogenase large subunit]
MSGVPEEGRIGSPARRIEDPRLLTGRGRYVADLTAPHLAHAAFLRSTVPHARITVDASAA
RTAPGVVAVFTAADLAGTLGPVSFDASIPGMTQLVHTALADDRVRLVGDPVAMVVAESRY
LAEDALELIEVRYDELPPVPDVATALDPAAPALYDVAPGNVPYHDTARYGDVDGAFRRAD
RVIGRTLRQHRYMAAPLETRGGLAAYEPAGGELTYHASAHAPHLMRMVLAAHLRLPPHRV
RVVVPDMGGSFGSKWGITREDLLVCAAAVRTGRPVRWIEDRRENLLVGGHARDESLHLEA
AVRADGTLLGLRARLVMDVGAYSVIPMNPAFFTLALRLLIPGPYRVPAYDFEVSTVCTNK
GPYVAYRGPWAVETWAREVLLDIIAGELGLAPEEIRRRNLVTPAEQPYRTAAGWRLDGTR
ASATLDRALELADLPRFRAEQRRARERGEVLGFGLATFIEPSPGGAEFLAMSGGGKETAR
VRVEPTGEVSLFTSQIPHGQGHETTLAQVVAAEFGLPYTAVRVVHGDTDATPFSMVGTGG
SRSATFGSGAAVRAARAVRDQVLRLASGMLGAPPEELELGGGRVFVRERPATGLTMVQLA
GMVSLAPAYLPPDTPTELAATATHDGADGGFAQATHCCWVRVDPGTGQVAVTRYLVVEDC
GSMINPAVVEGQIRGGTAQGLGGVLHERLHYDAAARPLTGTLRDYLLPTAADVPPIEIVH
LGPEPGAGPPDYRGVGEGGAICAPPAITNALSDALGTEITQQSVTPSFVLAALRKAGATP
PDLLDR
selected fasta
>putative oxidoreductase molybdopterin-binding subunit [putative carbon monoxide dehydrogenase large subunit]
ATGAGCGGCGTACCCGAGGAGGGCCGGATCGGCAGCCCGGCCCGGCGGATCGAGGACCCG
CGCCTGCTGACCGGCCGGGGCCGGTACGTGGCCGACCTGACCGCCCCGCACCTGGCCCAC
GCGGCGTTCCTCCGCAGCACCGTCCCGCACGCCCGGATCACCGTGGACGCCTCGGCGGCC
CGTACCGCCCCCGGGGTGGTCGCCGTCTTCACGGCGGCGGACCTCGCCGGGACGCTCGGC
CCGGTCAGCTTCGACGCCTCGATCCCCGGGATGACCCAGCTCGTGCACACCGCGCTCGCC
GACGACCGGGTGCGGCTGGTCGGCGACCCGGTGGCCATGGTGGTGGCGGAGAGCCGCTAC
CTGGCCGAGGACGCGCTGGAGCTGATCGAGGTCCGGTACGACGAGCTGCCCCCGGTGCCG
GACGTGGCGACCGCCCTCGACCCGGCCGCCCCGGCCCTGTACGACGTGGCGCCCGGCAAC
GTGCCGTACCACGACACCGCGCGGTACGGCGACGTCGACGGCGCCTTCCGCCGCGCGGAC
CGGGTGATCGGCCGGACGCTGCGGCAGCACCGGTACATGGCCGCGCCGCTGGAGACCCGG
GGCGGGCTGGCCGCGTACGAGCCGGCCGGCGGCGAGCTGACGTACCACGCCAGCGCGCAC
GCGCCGCACCTCATGCGGATGGTGCTCGCCGCGCACCTGCGGCTGCCGCCGCACCGGGTC
CGGGTGGTGGTGCCGGACATGGGTGGCTCGTTCGGGTCTAAGTGGGGCATCACCCGGGAG
GACCTGCTGGTGTGCGCGGCCGCCGTGCGCACCGGCCGGCCCGTGCGGTGGATCGAGGAC
CGCCGGGAGAACCTGCTGGTCGGCGGGCACGCCCGGGACGAGTCGCTGCACCTGGAGGCG
GCGGTACGGGCGGACGGCACCCTGCTCGGGCTGCGGGCGAGGCTCGTCATGGATGTCGGG
GCGTACTCGGTCATCCCCATGAACCCGGCGTTCTTCACGCTGGCGCTGCGGCTGCTGATC
CCCGGCCCCTACCGGGTGCCCGCGTACGACTTCGAGGTCAGCACGGTCTGCACGAACAAG
GGGCCGTACGTGGCGTACCGGGGGCCGTGGGCGGTGGAGACCTGGGCGCGGGAGGTGCTG
CTCGACATCATCGCCGGTGAGCTGGGGCTGGCGCCGGAGGAGATCCGCCGGCGCAACCTG
GTCACCCCGGCCGAGCAGCCGTACCGGACGGCGGCCGGGTGGCGGCTGGACGGGACGCGG
GCGTCGGCCACCCTGGACCGGGCGCTGGAGCTGGCCGACCTGCCCCGGTTCCGGGCCGAG
CAGCGGCGCGCCCGGGAGCGCGGCGAGGTGCTCGGCTTCGGGCTGGCCACCTTCATCGAG
CCGTCGCCGGGCGGTGCCGAGTTCCTCGCCATGTCCGGCGGCGGCAAGGAGACCGCCCGG
GTCCGCGTCGAGCCGACCGGCGAGGTCTCCCTGTTCACCTCGCAGATCCCGCACGGGCAG
GGGCACGAGACCACGCTCGCGCAGGTGGTGGCGGCCGAGTTCGGGCTGCCGTACACGGCC
GTGCGGGTGGTGCACGGTGACACCGACGCCACCCCGTTCAGCATGGTGGGCACCGGCGGG
AGCCGGTCCGCCACCTTCGGCAGCGGCGCGGCGGTCCGGGCCGCCCGGGCCGTACGCGAT
CAGGTTCTCCGCCTGGCCAGCGGGATGCTCGGCGCCCCGCCGGAGGAGCTGGAGCTGGGC
GGCGGCCGCGTCTTCGTGCGGGAGCGGCCGGCGACCGGGCTGACCATGGTGCAGCTCGCC
GGCATGGTCTCCCTGGCCCCGGCCTACCTGCCCCCGGACACGCCGACCGAGCTGGCGGCC
ACCGCCACCCACGACGGGGCGGACGGCGGGTTCGCCCAGGCCACCCACTGCTGCTGGGTA
CGGGTGGACCCGGGCACCGGACAGGTCGCGGTCACCCGGTACCTCGTGGTCGAGGACTGC
GGCTCGATGATCAATCCAGCCGTGGTCGAGGGGCAGATCCGCGGCGGCACGGCACAGGGA
CTGGGCGGGGTGCTCCACGAGCGGCTGCACTACGACGCGGCGGCGCGGCCCCTGACCGGC
ACCCTGCGGGACTATCTGCTGCCCACCGCGGCGGACGTGCCGCCGATCGAGATCGTGCAC
CTCGGCCCGGAGCCCGGGGCCGGTCCGCCGGACTACCGGGGGGTCGGTGAGGGGGGCGCC
ATCTGCGCGCCGCCGGCCATCACCAACGCGCTCTCCGACGCGTTGGGCACCGAGATCACC
CAGCAGTCGGTGACCCCGTCGTTCGTGCTCGCGGCGCTGCGCAAGGCCGGCGCGACACCC
CCGGACCTGCTTGACAGGTAG

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000674 Aldehyde oxidase/xanthine dehydrogenase, a/b hammerhead (Domain)
 [24-137]  9.7e-29 PF01315
PF01315   Ald_Xan_dh_C
 [24-137]  4.69998262513195e-47 SM01008
SM01008   Ald_Xan_dh_C
 [7-125]  3.80000000000003e-39 G3DSA:3.90.1170.50
G3DSA:3.90.1170.50   Aldxan_DH_hamm
 [10-160]  7.90003079443025e-46 SSF54665
SSF54665   Aldxan_dh_hamm
IPR008274 Aldehyde oxidase/xanthine dehydrogenase, molybdopterin binding (Domain)
 [126-192]  1.09999999999999e-39 G3DSA:3.30.365.10 [195-288]  1.2e-25 G3DSA:3.30.365.10 [290-367]  1.09999999999999e-39 G3DSA:3.30.365.10 [374-460]  1e-58 G3DSA:3.30.365.10 [475-640]  1.70000000000001e-39 G3DSA:3.30.365.10 [641-775]  1e-58 G3DSA:3.30.365.10
G3DSA:3.30.365.10   Ald_xan_DH_mo_bd
 [158-714]  1.60000000000002e-124 PF02738
PF02738   Ald_Xan_dh_C2
 [129-783]  SSF56003
SSF56003   Ald_xan_DH_mo_bd
SignalP No significant hit
TMHMM No significant hit