close all open/close all

CDS information : Dynm_00490


close this sectionLocation

Organism
StrainATCC 53710 (=NBRC 15963)
Entry nameDynemicin
Contig
Start / Stop / Direction62,762 / 62,268 / - [in whole cluster]
62,762 / 62,268 / - [in contig]
Locationcomplement(62268..62762) [in whole cluster]
complement(62268..62762) [in contig]
TypeCDS
Length495 bp (164 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.1 general function
Productputative oxidoreductase iron-sulfur binding subunit
Product (GenBank)putative carbon monoxide dehydrogenase small subunit
Geneorf22
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)
  • ORF36-2
Reference
ACC
PmId
[18328078] The biosynthetic genes encoding for the production of the dynemicin enediyne core in Micromonospora chersina ATCC53710. (FEMS Microbiol Lett. , 2008)
Related Reference
ACC
P19921
PmId
[7721710] Molecular characterization of the gene cluster coxMSL encoding the molybdenum-containing carbon monoxide dehydrogenase of Oligotropha carboxidovorans. (J Bacteriol. , 1995)
[10430865] Crystal structure and mechanism of CO dehydrogenase, a molybdo iron-sulfur flavoprotein containing S-selanylcysteine. (Proc Natl Acad Sci U S A. , 1999)
ACC
P72223
PmId
[8798497] Cloning, expression, and sequence analysis of the three genes encoding quinoline 2-oxidoreductase, a molybdenum-containing hydroxylase from Pseudomonas putida 86. (J Biol Chem. , 1996)
ACC
P19915
PmId
[10482497] Cloning and molecular characterization of the genes for carbon monoxide dehydrogenase and localization of molybdopterin, flavin adenine dinucleotide, and iron-sulfur centers in the enzyme of Hydrogenophaga pseudoflava. (J Bacteriol. , 1999)
[10966817] The effect of intracellular molybdenum in Hydrogenophaga pseudoflava on the crystallographic structure of the seleno-molybdo-iron-sulfur flavoenzyme carbon monoxide dehydrogenase. (J Mol Biol. , 2000)
[11076018] The role of Se, Mo and Fe in the structure and function of carbon monoxide dehydrogenase. (Biol Chem. , 2000)

close this sectionSequence

selected fasta
>putative oxidoreductase iron-sulfur binding subunit [putative carbon monoxide dehydrogenase small subunit]
MESVELLVNGVRREGRVEPRRTLADFLREDLGLTGTHVGCEQGACGACTVLLDGEPVYAC
LLFAVQARGHEITTVEGLAAPGELDPMQDAFRRCHALQCGFCTPGMLLAAHGLLADDPDP
DDAGIRIALAGNICRCTGYQSIVDAVRLAAAERRRSAAPDGAAR
selected fasta
>putative oxidoreductase iron-sulfur binding subunit [putative carbon monoxide dehydrogenase small subunit]
ATGGAGTCCGTCGAGCTGCTGGTGAACGGGGTACGCCGGGAGGGGCGGGTCGAGCCGCGC
CGGACGCTTGCCGACTTCCTCCGCGAGGATCTCGGGCTGACCGGCACGCACGTCGGCTGC
GAGCAGGGCGCCTGCGGCGCGTGCACGGTGCTCCTCGACGGCGAGCCGGTCTACGCCTGC
CTGCTCTTCGCCGTGCAGGCGCGGGGCCACGAGATCACCACGGTCGAGGGGCTGGCCGCC
CCGGGCGAGCTGGATCCCATGCAGGACGCCTTCCGCCGGTGCCACGCCCTCCAGTGCGGT
TTCTGCACCCCGGGCATGCTGCTGGCCGCGCACGGGCTGCTCGCCGACGACCCGGACCCG
GACGACGCGGGCATCCGGATCGCGCTCGCCGGCAACATCTGCCGCTGCACCGGCTACCAG
AGCATCGTGGACGCGGTCCGGCTCGCCGCGGCGGAGCGGCGCCGGTCGGCCGCGCCGGAC
GGAGCGGCGCGATGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001041 2Fe-2S ferredoxin-type domain (Domain)
 [1-79]  5.69999708783953e-28 SSF54292
SSF54292   Ferredoxin
 [2-78]  PS51085
PS51085   2FE2S_FER_2
 [8-56]  2.8e-07 PF00111
PF00111   Fer2
IPR002888 [2Fe-2S]-binding (Domain)
 [74-154]  7.0999832511256e-33 SSF47741
SSF47741   2Fe-2S_bind
 [74-147]  2.1e-30 PF01799
PF01799   Fer2_2
 [76-155]  4.5e-32 G3DSA:1.10.150.120
G3DSA:1.10.150.120   2Fe-2S-bd
IPR006058 2Fe-2S ferredoxin, iron-sulphur binding site (Binding_site)
 [40-48]  PS00197
PS00197   2FE2S_FER_1
IPR012675 Beta-grasp domain (Domain)
 [2-75]  5.90000000000001e-29 G3DSA:3.10.20.30
G3DSA:3.10.20.30   Ferredoxin_fold
SignalP No significant hit
TMHMM No significant hit