close all open/close all

CDS information : Dynm_00500


close this sectionLocation

Organism
StrainATCC 53710 (=NBRC 15963)
Entry nameDynemicin
Contig
Start / Stop / Direction63,656 / 62,778 / - [in whole cluster]
63,656 / 62,778 / - [in contig]
Locationcomplement(62778..63656) [in whole cluster]
complement(62778..63656) [in contig]
TypeCDS
Length879 bp (292 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.1 general function
Productputative oxidoreductase FAD-binding subunit
Product (GenBank)putative carbon monoxide dehydrogenase medium subunit
Geneorf23
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)
  • ORF36-3
Reference
ACC
PmId
[18328078] The biosynthetic genes encoding for the production of the dynemicin enediyne core in Micromonospora chersina ATCC53710. (FEMS Microbiol Lett. , 2008)
Related Reference
ACC
O87681
PmId
[11514508] Gene cluster on pAO1 of Arthrobacter nicotinovorans involved in degradation of the plant alkaloid nicotine: cloning, purification, and characterization of 2,6-dihydroxypyridine 3-hydroxylase. (J Bacteriol. , 2001)
ACC
P19914
PmId
[10482497] Cloning and molecular characterization of the genes for carbon monoxide dehydrogenase and localization of molybdopterin, flavin adenine dinucleotide, and iron-sulfur centers in the enzyme of Hydrogenophaga pseudoflava. (J Bacteriol. , 1999)
ACC
P19920
PmId
[7721710] Molecular characterization of the gene cluster coxMSL encoding the molybdenum-containing carbon monoxide dehydrogenase of Oligotropha carboxidovorans. (J Bacteriol. , 1995)
[10433972] Sequence analysis, characterization and CO-specific transcription of the cox gene cluster on the megaplasmid pHCG3 of Oligotropha carboxidovorans. (Gene. , 1999)

close this sectionSequence

selected fasta
>putative oxidoreductase FAD-binding subunit [putative carbon monoxide dehydrogenase medium subunit]
MKAAPFDHHAPTSLAEAHDLLARHGPDATLIAGGQSLVPLMALRLARPRVLVDLNGVAGL
AGIRDEPDAVTVGALTRQRAVERSPVVAARLPLLAEAVGRIGHPQVRNRGTVGGSLALGH
PAAELPAAALALDATVVLAGIGGVEREVAAGDFHTATGGTALRAGEVLTRVRYPVPPAGT
GHGFHELGRRARDFALAGAAVVLGRGGDGGCAYARVAVLGGGPAPRRLPGVERALRGGPL
DAEAIAEAAAGAAAEAEPVGDVQADAGYRREVLVTLVRRALSDAARRARPTH
selected fasta
>putative oxidoreductase FAD-binding subunit [putative carbon monoxide dehydrogenase medium subunit]
GTGAAGGCCGCGCCCTTCGACCACCACGCCCCGACCAGCCTCGCCGAGGCCCACGACCTC
CTCGCCCGGCACGGCCCGGACGCCACGCTGATCGCCGGTGGACAGAGCCTCGTGCCGCTC
ATGGCGCTGCGGCTGGCCCGGCCCCGGGTGCTGGTCGACCTCAACGGGGTGGCCGGCCTG
GCCGGGATCCGCGACGAGCCGGACGCCGTGACCGTCGGCGCGCTCACCCGTCAGCGGGCC
GTCGAGCGGTCCCCGGTGGTCGCCGCCCGGCTGCCGCTGCTCGCCGAGGCGGTCGGCCGG
ATCGGTCACCCGCAGGTGCGCAACCGCGGCACCGTGGGGGGCAGCCTGGCGCTCGGGCAT
CCCGCCGCCGAACTGCCCGCCGCCGCGCTCGCCCTGGACGCCACAGTGGTCCTCGCCGGC
ATCGGGGGCGTGGAGCGCGAGGTCGCGGCCGGGGACTTCCACACCGCGACGGGCGGCACG
GCGCTGCGGGCGGGCGAGGTGCTGACCCGGGTCCGGTACCCCGTGCCGCCGGCCGGCACC
GGCCACGGCTTCCACGAGCTGGGCCGCCGTGCGCGGGACTTCGCGCTGGCCGGCGCCGCC
GTGGTGCTCGGCCGGGGCGGTGACGGCGGGTGCGCGTACGCCCGGGTGGCGGTGCTGGGC
GGCGGCCCGGCGCCGCGTCGCCTGCCCGGCGTGGAGCGGGCGCTGCGCGGCGGACCCCTC
GACGCCGAGGCGATCGCGGAGGCCGCGGCCGGCGCCGCCGCCGAGGCCGAGCCGGTCGGC
GACGTGCAGGCCGACGCCGGGTACCGCCGCGAGGTGCTGGTGACCCTGGTCCGGCGGGCG
CTGTCCGACGCGGCGCGCCGGGCCCGACCGACACACTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR002346 Molybdopterin dehydrogenase, FAD-binding (Domain)
 [6-175]  8.60000000000005e-47 PF00941
PF00941   FAD_binding_5
IPR005107 CO dehydrogenase flavoprotein, C-terminal (Domain)
 [182-284]  1.70000295590054e-24 SM01092
SM01092   CO_deh_flav_C
 [183-284]  2.1e-25 G3DSA:3.30.390.50
G3DSA:3.30.390.50   CO_DH_flav_C
 [181-290]  1.99999636034521e-26 SSF55447
SSF55447   CO_deh_flav_C
 [186-284]  3e-19 PF03450
PF03450   CO_deh_flav_C
IPR016166 FAD-binding, type 2 (Domain)
 [1-179]  1.10000150671643e-51 SSF56176
SSF56176   FAD-binding_2
 [1-178]  PS51387
PS51387   FAD_PCMH
IPR016167 FAD-binding, type 2, subdomain 1 (Domain)
 [1-54]  1.1e-20 G3DSA:3.30.43.10
G3DSA:3.30.43.10   FAD-binding_2_sub1
IPR016169 CO dehydrogenase flavoprotein-like, FAD-binding, subdomain 2 (Domain)
 [61-174]  2.29999999999998e-36 G3DSA:3.30.465.10
G3DSA:3.30.465.10   CO_DH_flavoprot_FAD-bd_sub2
SignalP No significant hit
TMHMM No significant hit