close all open/close all

CDS information : Dynm_00510


close this sectionLocation

Organism
StrainATCC 53710 (=NBRC 15963)
Entry nameDynemicin
Contig
Start / Stop / Direction64,731 / 63,682 / - [in whole cluster]
64,731 / 63,682 / - [in contig]
Locationcomplement(63682..64731) [in whole cluster]
complement(63682..64731) [in contig]
TypeCDS
Length1,050 bp (349 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.2 modification methylation
Productputative O-methyltransferase
Product (GenBank)DynO6
GenedynO6
Gene (GenBank)
EC number2.1.1.-
Keyword
Note
Note (GenBank)
  • O-methyltransferase
Reference
ACC
PmId
[18328078] The biosynthetic genes encoding for the production of the dynemicin enediyne core in Micromonospora chersina ATCC53710. (FEMS Microbiol Lett. , 2008)
Related Reference
ACC
Q8KND2
NITE
Calm_00650
PmId
[21358050] Structural characterization of CalO1: a putative orsellinic acid methyltransferase in the calicheamicin-biosynthetic pathway. (Acta Crystallogr D Biol Crystallogr. , 2011)
ACC
Q9X5T6
NITE
Mito_00450*
PmId
[10099135] Molecular characterization and analysis of the biosynthetic gene cluster for the antitumor antibiotic mitomycin C from Streptomyces lavendulae NRRL 2564. (Chem Biol. , 1999)
[17461583] Hydroxyquinone O-methylation in mitomycin biosynthesis. (J Am Chem Soc. , 2007)

close this sectionSequence

selected fasta
>putative O-methyltransferase [DynO6]
MENPPQQFAPPVSVTVLEKLLGRLTSVCIQVATAGLDLPDRLRNGPKSIDELAAEVGGDR
DVLLLFMRALTSESIFQEVEPGVFAHTEESRCLISDAPNSLHGIAEMLGAEWAWKVWEPA
EVLHTIRTGQPAFEHVFGRDIWDYMTANRDQYAVFSRAQTIFSGPKDDAIVDAYDFEGVK
TIVDLGGGEGTFLEKILLKHPGIEGVLFDLPPVVERARARVAGSAVADRYTCVGGSFFDR
VPPGADAYVLKQVLHDWSDDESVEILRKVREVLPPSGRILVAAHLVPAPPRRPLKYLMAG
MWVRLNTPGGYERTEQEFRDVFDRAGLELVRILPTASTHSILETRRAED
selected fasta
>putative O-methyltransferase [DynO6]
ATGGAAAACCCACCGCAGCAGTTCGCGCCTCCCGTGTCGGTGACCGTGCTGGAGAAGCTG
CTCGGCCGGCTGACCTCGGTGTGCATCCAGGTCGCCACGGCCGGCCTCGATCTGCCCGAC
CGGCTCCGGAACGGTCCGAAGTCGATCGACGAGCTGGCCGCCGAGGTGGGCGGGGACCGG
GACGTGCTGCTGCTCTTCATGCGGGCGCTGACCAGCGAGTCGATCTTCCAGGAGGTCGAG
CCGGGGGTGTTCGCGCACACCGAGGAGTCCCGCTGCCTGATCAGCGACGCGCCGAACTCG
CTGCACGGCATCGCCGAGATGCTCGGGGCCGAGTGGGCCTGGAAGGTGTGGGAGCCGGCC
GAGGTGCTGCACACCATCCGCACCGGCCAGCCCGCCTTCGAGCACGTCTTCGGCCGGGAC
ATCTGGGACTACATGACGGCCAACCGCGACCAGTACGCCGTGTTCAGCCGCGCCCAGACC
ATCTTCTCCGGGCCGAAGGACGACGCGATCGTCGACGCGTACGACTTCGAGGGCGTCAAG
ACCATCGTCGACCTCGGCGGCGGTGAGGGCACCTTCCTGGAGAAAATCCTGCTCAAGCAC
CCGGGGATCGAGGGCGTCCTGTTCGACCTGCCGCCCGTGGTGGAGCGGGCCCGGGCGCGG
GTGGCCGGCAGCGCCGTCGCCGACCGCTACACCTGTGTGGGCGGCAGCTTCTTCGACCGG
GTGCCGCCGGGCGCCGACGCGTACGTGCTCAAGCAGGTGCTGCACGACTGGAGCGACGAC
GAGTCGGTGGAGATCCTGCGCAAGGTCCGCGAGGTGCTGCCGCCGTCGGGCCGGATCCTG
GTGGCCGCGCACCTGGTGCCCGCGCCGCCGCGCCGCCCGCTGAAGTACCTGATGGCCGGC
ATGTGGGTGCGGCTCAACACGCCGGGCGGCTACGAGCGGACCGAGCAGGAGTTCCGCGAC
GTGTTCGACCGGGCCGGCCTGGAGCTGGTCCGGATCCTGCCCACCGCCTCCACGCACAGC
ATTCTGGAGACCCGCCGCGCCGAGGACTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001077 O-methyltransferase, family 2 (Domain)
 [82-322]  2.59999999999998e-56 PF00891
PF00891   Methyltransf_2
IPR011991 Winged helix-turn-helix transcription repressor DNA-binding (Domain)
 [20-90]  1.6e-06 G3DSA:1.10.10.10
G3DSA:1.10.10.10   Wing_hlx_DNA_bd
IPR016461 O-methyltransferase, caffeic acid-type (Family)
 [1-346]  5.7999965385478e-16 PIRSF005739
PIRSF005739   O-mtase
SignalP No significant hit
TMHMM No significant hit