close all open/close all

CDS information : Dynm_00530


close this sectionLocation

Organism
StrainATCC 53710 (=NBRC 15963)
Entry nameDynemicin
Contig
Start / Stop / Direction66,804 / 65,887 / - [in whole cluster]
66,804 / 65,887 / - [in contig]
Locationcomplement(65887..66804) [in whole cluster]
complement(65887..66804) [in contig]
TypeCDS
Length918 bp (305 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category4.3 transport
Productputative ABC transporter ATP-binding protein
Product (GenBank)putative ABC transporter ATP-binding protein
GenedynT10
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)
  • ORF38
Reference
ACC
PmId
[18328078] The biosynthetic genes encoding for the production of the dynemicin enediyne core in Micromonospora chersina ATCC53710. (FEMS Microbiol Lett. , 2008)
Family/Domain
FD
IPR003593, IPR003439

close this sectionSequence

selected fasta
>putative ABC transporter ATP-binding protein [putative ABC transporter ATP-binding protein]
MPQENSYPALQAEGLTKQYGKRLALADCNLNVPRGRVVGLVGPNGAGKSTLLNLACGLIT
PTAGSLRVLGSPPAANAAHLAKVGFVAQDTPVYGTFTVADHLRMGAKLNPSWDQSLADRR
IAQVGLNLKQKAGRLSGGQRAQLALTIAAAKRPELLIFDEPAAALDPLARDGFMQNLMEF
VAELGASAILSSHLLSDVERVCDYLIVLCASRVQVAGEVKDLLAQHYRLVAPRGELDRLP
AEVEVIRMQHTDQYSRAVVRVAGALPRTPWSVEPVSLEEMVLSYMTRAAGVSAGLADAMA
GEAVR
selected fasta
>putative ABC transporter ATP-binding protein [putative ABC transporter ATP-binding protein]
ATGCCACAGGAGAATTCCTATCCCGCACTCCAGGCCGAGGGTCTGACGAAGCAATACGGC
AAGCGGCTCGCGCTGGCCGACTGCAACCTCAACGTCCCCCGCGGACGGGTGGTCGGCCTG
GTCGGGCCGAACGGCGCCGGCAAGTCCACACTGCTGAACCTCGCCTGCGGGCTGATCACG
CCGACGGCGGGAAGCCTGCGGGTGCTCGGTTCGCCTCCGGCGGCGAACGCGGCGCACCTG
GCCAAGGTCGGGTTCGTCGCGCAGGACACCCCGGTCTACGGCACGTTCACCGTGGCTGAC
CACCTGCGGATGGGCGCGAAGCTGAACCCGTCCTGGGACCAGTCCCTGGCCGACCGGCGG
ATCGCGCAGGTCGGGCTCAACCTCAAGCAGAAGGCGGGCCGGCTCTCCGGCGGCCAGCGT
GCCCAGCTGGCGCTGACCATCGCCGCCGCGAAGCGCCCGGAGCTGCTGATCTTCGACGAG
CCGGCCGCCGCGCTGGACCCGCTGGCCCGGGACGGGTTCATGCAGAACCTTATGGAGTTC
GTCGCCGAACTGGGTGCCAGCGCGATCCTCTCCTCGCACCTGCTCAGCGACGTGGAGCGG
GTGTGCGACTACCTCATCGTGCTCTGCGCCTCCCGGGTGCAGGTCGCCGGCGAGGTGAAG
GACCTGCTGGCCCAGCACTATCGGCTGGTCGCCCCGCGCGGCGAGCTGGACCGGCTGCCG
GCGGAGGTCGAGGTCATCCGCATGCAGCACACCGACCAGTACAGCCGCGCGGTCGTGCGG
GTGGCCGGCGCGCTGCCGCGTACGCCGTGGAGCGTCGAGCCGGTCTCGCTGGAGGAGATG
GTCCTCAGCTACATGACCCGGGCGGCGGGCGTCTCCGCCGGCCTGGCGGACGCCATGGCG
GGGGAGGCCGTACGGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR003439 ABC transporter-like (Domain)
 [49-162]  1.2e-16 PF00005
PF00005   ABC_tran
 [10-235]  PS50893
PS50893   ABC_TRANSPORTER_2
IPR003593 AAA+ ATPase domain (Domain)
 [34-235]  4.99999811956429e-16 SM00382
SM00382   AAA
SignalP No significant hit
TMHMM No significant hit