close all open/close all

CDS information : Dynm_00540


close this sectionLocation

Organism
StrainATCC 53710 (=NBRC 15963)
Entry nameDynemicin
Contig
Start / Stop / Direction67,972 / 66,977 / - [in whole cluster]
67,972 / 66,977 / - [in contig]
Locationcomplement(66977..67972) [in whole cluster]
complement(66977..67972) [in contig]
TypeCDS
Length996 bp (331 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.4 hypothetical protein
Producthypothetical protein
Product (GenBank)putative transmembrane transport protein
GenedynT11
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)
  • ORF39
Reference
ACC
PmId
[18328078] The biosynthetic genes encoding for the production of the dynemicin enediyne core in Micromonospora chersina ATCC53710. (FEMS Microbiol Lett. , 2008)

close this sectionSequence

selected fasta
>hypothetical protein [putative transmembrane transport protein]
MIWMSWRQFRTQALVGVVALAPLAAYLLFTGLDIRQAYDRYQDRCAVADRCLDAMSQFQD
DYRTRLLFLALLLAIIPAVLGVFWGAPLIARELESGTQRLVWNQSVTRRRWLAVKLLFVG
LASMAVAALASLLLTWAASPYDKVSGERFAALAFGARNLTPIAYAALAFVLGTVIGLLMR
KTVPAMALTILAFTLLQFLIPNMVRPHLMEPVTVTKAMTADALRELRGVGTDATVKGLSI
PNAWVTGTSKLLTAGGQPVDARTIDTCLTRPQSGGAADTAACLGERNLHVTVDYQPNSRY
WSFQWIESALYLALAGLLAGFGLWRIQRHVS
selected fasta
>hypothetical protein [putative transmembrane transport protein]
ATGATCTGGATGAGTTGGCGGCAGTTCCGCACCCAGGCCCTCGTCGGCGTCGTCGCGCTG
GCGCCGCTGGCGGCCTACCTCCTGTTCACCGGTCTGGACATCCGGCAGGCGTACGACCGC
TACCAGGACCGGTGCGCGGTCGCCGACCGGTGCCTGGACGCGATGAGCCAGTTCCAGGAC
GACTACCGCACCCGGCTGCTCTTCCTCGCCCTGCTGCTGGCGATCATCCCGGCGGTGCTG
GGCGTGTTCTGGGGTGCGCCGCTGATCGCCCGGGAGTTGGAGTCGGGCACGCAGCGGCTG
GTCTGGAACCAGAGCGTCACCCGGCGCCGCTGGCTGGCGGTCAAGCTGCTCTTCGTCGGC
CTGGCCAGCATGGCGGTCGCGGCCCTGGCCAGCCTGCTGCTGACCTGGGCGGCGAGCCCC
TACGACAAGGTGTCCGGGGAGCGGTTCGCGGCGCTGGCGTTCGGCGCCCGCAACCTGACG
CCGATCGCGTACGCGGCGCTGGCCTTCGTGCTGGGCACGGTCATCGGGCTGCTGATGCGC
AAGACGGTGCCGGCCATGGCGTTGACGATCCTGGCCTTCACACTGCTCCAGTTCCTGATA
CCGAACATGGTCCGGCCGCACCTCATGGAGCCGGTCACCGTGACGAAGGCGATGACCGCC
GACGCGCTCCGCGAGCTGCGTGGGGTGGGCACCGACGCCACGGTGAAGGGCCTGAGCATC
CCGAACGCCTGGGTGACCGGCACCAGCAAGCTGCTCACCGCCGGCGGGCAGCCGGTCGAC
GCCCGGACCATCGACACCTGTCTGACCAGGCCGCAGTCGGGGGGCGCCGCGGACACCGCG
GCCTGCCTCGGCGAGCGGAACCTGCATGTCACGGTCGACTACCAGCCCAACAGCCGCTAC
TGGTCGTTCCAGTGGATCGAGTCGGCGCTCTACCTGGCGCTCGCGGGGCTGCTGGCCGGC
TTCGGCCTGTGGCGGATCCAGCGCCACGTGAGCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
No significant hit
SignalP No significant hit
TMHMM
 [13-32]  Transmembrane (i-o) [67-89]  Transmembrane (o-i) [116-138]  Transmembrane (i-o) [153-175]  Transmembrane (o-i) [182-204]  Transmembrane (i-o) [302-324]  Transmembrane (o-i)
Transmembrane 6