close all open/close all

CDS information : Dynm_00550


close this sectionLocation

Organism
StrainATCC 53710 (=NBRC 15963)
Entry nameDynemicin
Contig
Start / Stop / Direction68,128 / 68,697 / + [in whole cluster]
68,128 / 68,697 / + [in contig]
Location68128..68697 [in whole cluster]
68128..68697 [in contig]
TypeCDS
Length570 bp (189 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.4 hypothetical protein
Producthypothetical protein
Product (GenBank)putative 2-component system sensor kinase
GenedynR10
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)
  • ORF40
Reference
ACC
PmId
[18328078] The biosynthetic genes encoding for the production of the dynemicin enediyne core in Micromonospora chersina ATCC53710. (FEMS Microbiol Lett. , 2008)

close this sectionSequence

selected fasta
>hypothetical protein [putative 2-component system sensor kinase]
MGRMDTSDRSARGAGIAFDIAFALAAVLGMAFTAYMISDSWGGSYAVFDTAVAAVVSLLA
LGRRINRTWTAVAGLVVVAVAILVSQVADLPQEPSPIASLALAVLVASALRHLPTQWGWG
IAAGGLAVILACWITGGFRAVAVMGTVAWLGAVAVGASMRGADASKRAAVERRRAAEEAN
RQWDPTRTF
selected fasta
>hypothetical protein [putative 2-component system sensor kinase]
GTGGGTCGCATGGACACTTCGGACCGGTCGGCCCGCGGGGCCGGAATCGCCTTCGACATC
GCCTTCGCCCTGGCAGCCGTGCTGGGCATGGCCTTCACCGCCTACATGATCAGCGACAGC
TGGGGCGGCAGCTACGCGGTCTTCGACACCGCCGTGGCCGCGGTGGTGTCCCTGCTCGCG
CTGGGTCGCCGGATCAACCGCACCTGGACGGCCGTCGCCGGCCTGGTCGTGGTCGCCGTG
GCGATCCTCGTCTCGCAGGTCGCCGACCTGCCGCAGGAGCCCAGCCCCATCGCCTCGCTG
GCGCTGGCCGTGCTGGTCGCCTCGGCGCTGCGGCACCTGCCCACCCAGTGGGGCTGGGGC
ATCGCCGCCGGCGGCCTCGCCGTCATCCTCGCCTGCTGGATCACCGGCGGCTTCCGGGCC
GTCGCCGTGATGGGCACCGTGGCGTGGCTCGGCGCCGTCGCGGTCGGCGCGTCGATGCGC
GGAGCGGACGCGAGCAAGCGAGCAGCCGTCGAGCGTCGCCGGGCGGCCGAGGAGGCCAAC
CGGCAGTGGGACCCCACCCGCACCTTCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro No significant hit
SignalP No significant hit
TMHMM
 [13-35]  Transmembrane (i-o) [45-62]  Transmembrane (o-i) [69-88]  Transmembrane (i-o) [116-138]  Transmembrane (o-i)
Transmembrane 4